[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59126.1
DDBJ      :             MotA/TolQ/ExbB proton channel
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  478/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   106->207 PF01618 * MotA_ExbB 5e-19 50.0 %
:HMM:PFM   74->210 PF01618 * MotA_ExbB 6.5e-36 35.8 137/139  
:BLT:SWISS 10->198 Y1022_METTH 1e-17 31.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59126.1 GT:GENE ABA59126.1 GT:PRODUCT MotA/TolQ/ExbB proton channel GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3029300..3030061 GB:FROM 3029300 GB:TO 3030061 GB:DIRECTION + GB:PRODUCT MotA/TolQ/ExbB proton channel GB:PROTEIN_ID ABA59126.1 GB:DB_XREF GI:76884445 InterPro:IPR002898 LENGTH 253 SQ:AASEQ MTELCTLEKYLTTAEEYLRTVLEIIKAGGWLMLPILACSIVAIGIIIERFWFLRRQRVVPKHIASQIWQWQYRNQLDKIHIKSVRESSPLGRILAAGLANRNRSREIMKESIEDVGRHVTLELERFLNTLGTIAAITPLLGLLGTVIGMIKVFTVITAQGVDNPAVLAGGISEALITTAAGLAVAIPSLMFYRYFHGRVMRLVVDMEEQAIKLVEVMHGDRELDPTENLAARVSIESSLKSDVEHHEYTPGPV GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 10->198|Y1022_METTH|1e-17|31.6|187/279| TM:NTM 3 TM:REGION 24->46| TM:REGION 132->154| TM:REGION 174->196| RP:PFM:NREP 1 RP:PFM:REP 106->207|PF01618|5e-19|50.0|102/132|MotA_ExbB| HM:PFM:NREP 1 HM:PFM:REP 74->210|PF01618|6.5e-36|35.8|137/139|MotA_ExbB| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF01618|IPR002898| GO:PFM GO:0008565|"GO:protein transporter activity"|PF01618|IPR002898| GO:PFM GO:0016020|"GO:membrane"|PF01618|IPR002898| OP:NHOMO 983 OP:NHOMOORG 484 OP:PATTERN --------------------------------111--------------------------------- 222---------------------------------------------------------------------------------12112222-2221--22112222121-------1--1111111111111113----------52-11111111------21-1-1--------------11-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------21115111-11111232222113223111111111111-22122121-12-12221111111121222111-1--1--444444444222123-11--------111111111111111-----22-2122221--111-2------2-------3-5212112221353332233223321332211111111223242432232141-222--112121144445454-12-1--11-------------2----66561416555432344443333333335332--13322------22131122222222222-2222222222222222222222331112222222222222222222222222-11111111111111141111111115322111111-1111--11133333443415622223344123234544111111111-4554333334434422222222223333--11332222----------------------------------------------333 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------2------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 78-87, 159-165, 220-234, 247-249, 251-253| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHEEccccccccccccccccc //