[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59130.1
DDBJ      :             Protein of unknown function DUF343
Swiss-Prot:Y2677_NITOC  RecName: Full=UPF0434 protein Noc_2677;

Homologs  Archaea  0/68 : Bacteria  338/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.171.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->56 2js4A PDBj 1e-15 53.6 %
:RPS:SCOP  2->59 2hf1A1  b.171.1.1 * 6e-15 56.9 %
:HMM:PFM   2->40 PF03966 * Trm112p 1.6e-13 51.3 39/68  
:BLT:SWISS 1->59 Y2677_NITOC 6e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59130.1 GT:GENE ABA59130.1 GT:PRODUCT Protein of unknown function DUF343 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3033273..3033452 GB:FROM 3033273 GB:TO 3033452 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF343 GB:PROTEIN_ID ABA59130.1 GB:DB_XREF GI:76884449 InterPro:IPR005651 LENGTH 59 SQ:AASEQ MDKKLLEILACPVCKSSLIYKKADQELICKACRLAYPIRDDIPVMLEEQARQFDPEEEI GT:EXON 1|1-59:0| SW:ID Y2677_NITOC SW:DE RecName: Full=UPF0434 protein Noc_2677; SW:GN OrderedLocusNames=Noc_2677; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->59|Y2677_NITOC|6e-31|100.0|59/59| BL:PDB:NREP 1 BL:PDB:REP 1->56|2js4A|1e-15|53.6|56/70| HM:PFM:NREP 1 HM:PFM:REP 2->40|PF03966|1.6e-13|51.3|39/68|Trm112p| RP:SCP:NREP 1 RP:SCP:REP 2->59|2hf1A1|6e-15|56.9|58/59|b.171.1.1| OP:NHOMO 341 OP:NHOMOORG 339 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------1----1----------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111--11111111111111------------11111111111-12-1111111111111111-1111--11111111111111-1-1-111111---------------------------11111111111111111111111111111111111111111111111111111111111111111111-11-111--11--------1--1-11-11-1---1-------------------------11111111111111111111111111111111---1--1------11111111111111-11-1111111111111111111111111111111111111111111111111111-11-111111111--1111-11111111111----1-------11-----------121111111111111111-1111111111-111111111-111----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTTcccEEEETTTTEEEETTTTEEEEEETTEEcccGGGcEEccccHHc DISOP:02AL 53-59| PSIPRED ccHHHHHEEccccccccEEEEccccEEEcccccEEccccccccEEcHHHcccccccccc //