[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59134.1
DDBJ      :             Glyoxalase I
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  468/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:127 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->125 1f9zA PDBj 1e-40 59.2 %
:RPS:PDB   1->127 3e0rA PDBj 6e-20 16.7 %
:RPS:SCOP  1->127 1sqiA1  d.32.1.3 * 5e-24 21.3 %
:HMM:SCOP  1->127 1f9zA_ d.32.1.1 * 1.9e-37 39.4 %
:RPS:PFM   2->60 PF00903 * Glyoxalase 2e-07 47.3 %
:HMM:PFM   2->123 PF00903 * Glyoxalase 2.1e-28 32.5 120/128  
:BLT:SWISS 1->127 LGUL_NEIMB 2e-52 73.2 %
:PROS 5->26|PS00934|GLYOXALASE_I_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59134.1 GT:GENE ABA59134.1 GT:PRODUCT Glyoxalase I GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3037443..3037826 GB:FROM 3037443 GB:TO 3037826 GB:DIRECTION + GB:PRODUCT Glyoxalase I GB:PROTEIN_ID ABA59134.1 GB:DB_XREF GI:76884453 InterPro:IPR004360 InterPro:IPR004361 LENGTH 127 SQ:AASEQ MRILHTMLRVGNLERSLKFYTDVLGMQLLRQKDYPEGRFTLAFVGYGDETAHTVLELTHNWDTEHYDLGDGFGHIAIAVTDAAAACAEIKKRGGKVVREAGPMKHGTTVIAFVEDPDGYKIELIERK GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 1->127|LGUL_NEIMB|2e-52|73.2|127/138| PROS 5->26|PS00934|GLYOXALASE_I_1|PDOC00720| SEG 75->89|iaiavtdaaaacaei| BL:PDB:NREP 1 BL:PDB:REP 1->125|1f9zA|1e-40|59.2|125/128| RP:PDB:NREP 1 RP:PDB:REP 1->127|3e0rA|6e-20|16.7|114/235| RP:PFM:NREP 1 RP:PFM:REP 2->60|PF00903|2e-07|47.3|55/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 2->123|PF00903|2.1e-28|32.5|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->127|1sqiA1|5e-24|21.3|127/149|d.32.1.3| HM:SCP:REP 1->127|1f9zA_|1.9e-37|39.4|127/0|d.32.1.1|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 804 OP:NHOMOORG 631 OP:PATTERN -------------------------111---------------------------------------- ----------------------------------------------------------------------------------2---------------------------------------------------------------11111111-1111111111-11111111-1111--11------------------------------------------111111----------------------1-------------------------1111---1111111111111111111111111111111111111-11-1------------11-111---11--------------------11---1112-----222111112111122222122222-22122122111-111111111111211112-112112-12222222223212111-----------------------------11121-111111111111111111111111111111111-122113211111111111111111-1111111111211---------------------1-111111---------------------------11211221122211211112111111112122--11121------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----11111212111111111111111111111111-11133231111211111111111-11111113221111133223111111111111111-1-11--------------------------------------------------11- ----111-21----111111111111111-111111121111111-111111111111111111111111111111111111111111-1211111111--1-211---12333321-2--11221-213D2-22221--2-14212--12112-1122321-22222333-13122115-1-224366162-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEEEccHHHHHHHHTTTTcEEEEEcccEGGGTEEEEEEEEEcTTccEEEEEEEccTcccccccccEEEEEEEEEccHHHHHHHHTTcccccEEccEEEccccEEEEEEcTTccEEEEEccc PSIPRED ccEEEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccccccEEEEEEcccccccccccccccEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEEcccccEEEEEEcc //