[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59147.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->64 PF12088 * DUF3565 4e-17 66.7 %
:HMM:PFM   6->62 PF12088 * DUF3565 3e-35 64.9 57/61  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59147.1 GT:GENE ABA59147.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3053236..3053445) GB:FROM 3053236 GB:TO 3053445 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59147.1 GB:DB_XREF GI:76884466 LENGTH 69 SQ:AASEQ MKRKIVDYHQDEHGDWVADLECGHGQHVRHRPPFINRSWVVTAEGRQSMVGQVLNCVKCQRPFPGGRGL GT:EXON 1|1-69:0| RP:PFM:NREP 1 RP:PFM:REP 8->64|PF12088|4e-17|66.7|57/60|DUF3565| HM:PFM:NREP 1 HM:PFM:REP 6->62|PF12088|3e-35|64.9|57/61|DUF3565| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ---1----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------111---111-----------------------------1-1-----------------------------11---------------------------------1-1-1-1-----11-------11--1---1------------------------------------------------------------------------------------------------------------------------------------------1---111111---111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 67-69| PSIPRED cccccccccccccccEEEEEEcccccccccccccccccEEEcHHHHHHcccEEEccccccccccccccc //