[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59161.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   113->182 PF08784 * RPA_C 3e-04 34.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59161.1 GT:GENE ABA59161.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3070692..3071321 GB:FROM 3070692 GB:TO 3071321 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59161.1 GB:DB_XREF GI:76884480 LENGTH 209 SQ:AASEQ MNFQPSPLQALILWRLLTSEGRAYLTDIRPKPKRRDREALLEAKFIEEQWRRKPQGSRAIYVQLTDRAWAWAGEHMDAKLSHRSPAAGPILQSFLARLQPILQSRHITLAEIFSSTQAPPPSEDSEQQLREAYFHLSGGERNIRVRLAQLRQQLGAIPRPRLDELLLKLQREGKLVLSPLDDSREILPEDQKAALSVAGFKRHLVYMQK GT:EXON 1|1-209:0| RP:PFM:NREP 1 RP:PFM:REP 113->182|PF08784|3e-04|34.8|69/99|RPA_C| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------1------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 115-130| PSIPRED ccccccHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEcccccHHHccccHHHHHHHHHHHHHHHEEcc //