[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59174.1
DDBJ      :             Conserved hypothetical protein 155
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  241/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:413 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   128->198 PF04403 * PqiA 8e-12 43.7 %
:RPS:PFM   258->408 PF04403 * PqiA 2e-31 51.7 %
:HMM:PFM   46->201 PF04403 * PqiA 1.6e-43 36.5 156/160  
:HMM:PFM   255->412 PF04403 * PqiA 1.9e-55 51.3 156/160  
:HMM:PFM   210->244 PF06906 * DUF1272 0.00028 34.3 35/57  
:BLT:SWISS 11->408 PQIA_SHIFL 2e-66 39.8 %
:TM
:REPEAT 2|4->198|217->408
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59174.1 GT:GENE ABA59174.1 GT:PRODUCT Conserved hypothetical protein 155 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3090347..3091588 GB:FROM 3090347 GB:TO 3091588 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein 155 GB:PROTEIN_ID ABA59174.1 GB:DB_XREF GI:76884493 InterPro:IPR005219 InterPro:IPR007498 LENGTH 413 SQ:AASEQ MDFSAQATLAVCHHCDWVMTLPRLRAGETACCPRCEHKLPGQQHTSIQSQLAWASAALIMLAAAIAFPFVSFEVQGIKHTIIVADTALALFDYDFPFLGLVVLTTTILLPTAYLLVLLYLHGVLASGRRPMGAQTLARLLTSIKPWVMSDVFVVGVLVSMIKVLSLASLQLGPAFPAFCAYAVLLLKSISSFDPGTLWTAISGPVDPPVDLAPGSPAATQGAAGCTRCNAIVNTASQTRCPRCGYHPIAPNPRRLQATWALLIAAGILYIPAMAYPIMITTELGRTSPQTVVGGARLLLETGSWPIALIIFTASIVVPIGKVLALGWLCLQAQAGTGRSAYDRLRLYRLVEAIGRWSFLDVFVVALLTALIQAGELMRVQPSPGVVIFAIVVILTMLAAMAFDPRLIWRVHEK GT:EXON 1|1-413:0| BL:SWS:NREP 1 BL:SWS:REP 11->408|PQIA_SHIFL|2e-66|39.8|394/417| TM:NTM 7 TM:REGION 50->72| TM:REGION 92->114| TM:REGION 158->180| TM:REGION 259->281| TM:REGION 308->330| TM:REGION 355->377| TM:REGION 384->406| NREPEAT 1 REPEAT 2|4->198|217->408| SEG 51->66|lawasaalimlaaaia| SEG 98->125|lglvvltttillptayllvllylhgvla| RP:PFM:NREP 2 RP:PFM:REP 128->198|PF04403|8e-12|43.7|71/156|PqiA| RP:PFM:REP 258->408|PF04403|2e-31|51.7|149/156|PqiA| HM:PFM:NREP 3 HM:PFM:REP 46->201|PF04403|1.6e-43|36.5|156/160|PqiA| HM:PFM:REP 255->412|PF04403|1.9e-55|51.3|156/160|PqiA| HM:PFM:REP 210->244|PF06906|0.00028|34.3|35/57|DUF1272| OP:NHOMO 409 OP:NHOMOORG 242 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11----12-11111111111111-------------------------------------111113222222-21244242222223322223-2221-1-------2--21---11-1111111------1---1-2----1---2--1----2--------------------------------3--1111-1111111111111222211-11112---1---------22222222222222222-2222222222222222222222331122222222222222222422322221-222222222222--1-----------2-111111111111-11111111111---4--32223332-3332--1----------11122222222111----------------2------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 210-211, 411-413| PSIPRED cccccccccEEEccccccEEccccccccEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEccEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccHHHcccEEcccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcc //