[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59178.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.3.5d.113.1
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   39->98 3cbrB PDBj 9e-05 21.7 %
:RPS:SCOP  48->115 1ti2B1  b.3.5.1 * 5e-05 18.2 %
:RPS:SCOP  120->216 1vk6A2  d.113.1.4 * 9e-04 17.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59178.1 GT:GENE ABA59178.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3094690..3095409) GB:FROM 3094690 GB:TO 3095409 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59178.1 GB:DB_XREF GI:76884497 LENGTH 239 SQ:AASEQ MLKLPTNFLANATLPLWVGLLLLLSAWGGFAGPLWAASLQIQVLAEGEGTPLENASVCLGTSPNPQQFGAYLTDEKGEVWLDEMQPIPFILIVSKAGFRGEGRVAGRQRIDRVMVASLAPGGGGPACDVSSQAAKREPSAAELQVKHLVINGSAPLTLNREVTLSFTVEGEPTEYRASQFPDFRDVQWQAFVSAPLFELSPGSGEKIIYFQVRRYQEVENSYLQMVSNTIKENIYFSDR GT:EXON 1|1-239:0| TM:NTM 1 TM:REGION 16->38| SEG 14->24|lplwvglllll| RP:PDB:NREP 1 RP:PDB:REP 39->98|3cbrB|9e-05|21.7|60/97| RP:SCP:NREP 2 RP:SCP:REP 48->115|1ti2B1|5e-05|18.2|66/79|b.3.5.1| RP:SCP:REP 120->216|1vk6A2|9e-04|17.7|96/131|d.113.1.4| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 25.1 SQ:SECSTR ######################################EEEEEEETTTTEEccccEEEEEEcccEEEEEEEEccTTcEEccTTcccEEEEEEEEcccc############################################################################################################################################# DISOP:02AL 1-2, 130-141, 238-239| PSIPRED ccccccHHHHcccHHHHHHHHHHHHHccccccccEEEEEEEEEEEccccccccccEEEEcccccHHHcccEEEcccccEEccccccccEEEEEEccccccccccHHHHHHHHHHHEEEcccccccccccccHHHHccccHHHEEEEEEEEEccccEEEEEEEEEEEEEEcccHHHHHcccccccccEEEEEEEEEEEEEccccccEEEEEEEEEcccHHHHHHHHHHHHHHHcEEEccc //