[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59183.1
DDBJ      :             Heat shock protein Hsp20
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  366/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->139 3glaB PDBj 1e-20 44.9 %
:RPS:PDB   44->141 2byuA PDBj 7e-21 35.7 %
:RPS:SCOP  4->137 1gmeA  b.15.1.1 * 4e-24 29.3 %
:HMM:SCOP  2->147 1gmeA_ b.15.1.1 * 5.5e-35 36.3 %
:RPS:PFM   47->147 PF00011 * HSP20 7e-15 43.0 %
:HMM:PFM   47->146 PF00011 * HSP20 3.6e-25 37.8 98/102  
:BLT:SWISS 42->146 SP21_STIAU 4e-17 38.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59183.1 GT:GENE ABA59183.1 GT:PRODUCT Heat shock protein Hsp20 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3100180..3100626 GB:FROM 3100180 GB:TO 3100626 GB:DIRECTION + GB:PRODUCT Heat shock protein Hsp20 GB:PROTEIN_ID ABA59183.1 GB:DB_XREF GI:76884502 InterPro:IPR002068 LENGTH 148 SQ:AASEQ MAIRHYESFDLLNQLQREVNRLFEGNSPQHTQTEAELATSDWVPAVDIKEEADRFVIYADVPGVESKDIEVTLDNGTLTLKGHRQSSKIPEQRGYKRVERVSGSFLRRFALPNTVDAAKVSARSQNGVLELVIPKSQQAQSRKITVEG GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 42->146|SP21_STIAU|4e-17|38.1|105/188| BL:PDB:NREP 1 BL:PDB:REP 42->139|3glaB|1e-20|44.9|98/99| RP:PDB:NREP 1 RP:PDB:REP 44->141|2byuA|7e-21|35.7|98/101| RP:PFM:NREP 1 RP:PFM:REP 47->147|PF00011|7e-15|43.0|100/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 47->146|PF00011|3.6e-25|37.8|98/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 4->137|1gmeA|4e-24|29.3|133/150|b.15.1.1| HM:SCP:REP 2->147|1gmeA_|5.5e-35|36.3|146/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 831 OP:NHOMOORG 433 OP:PATTERN -----------------------1----11--------------1--111121-1111111------- 21211---------122----11111-----1111111322131-----1121-111-----11--12--2-----------511222--------1--1-2-1-11231---------------22121222212111221112233242211111-------11-3263------------1112221--1-11111-111--2-----11--1--111------------------------------1----1111----22---1-----1------------------------------------------1-------112221221-2-1-111-----1--2-3-212--211-3-111----1222--4-----1-41333211-11----------4-1421513113------1141-1-2-------1-1-----11111111111-----------------------3-1-------1-1--4------522234735555426555544117342---64112111-3112-2-222-11--------11241136441436132224-525334133134224461---1---------------1111222--1-21--1-21-----------1----1----2112-------------------------------------------1------------------------------------------------11111111224-23--------------------------21---------4-1-1----11111-111----------------111111111111--3-112211---1-11-1---------------------------1-1111111111- 2---112-21--114-----11-1111----------2111111---1-----------------3--------------------27-532-372-----3-1-1-1-4-----------------------------------------------------------------2121-1--23G388-B5------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 97.3 SQ:SECSTR ####EcccccGGGEEEETTTEEccccccccccccccccEcEEEccEEEEEcccEEEEEEEcTTccGGGEEEEETTTEEEEEEccccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEcccccccccccccc DISOP:02AL 28-40, 86-89, 137-145, 147-148| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEEEEEEEccccccEEEEEEEccEEEEEEEEcccccccccEEEEEEEEccEEEEEEEccccccccEEEEEEEccEEEEEEEccccccccEEEEcc //