[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59187.1
DDBJ      :             Glycoside hydrolase, family 57
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:394 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->200 1k1xA PDBj 8e-12 32.8 %
:RPS:PDB   85->182 2c1iA PDBj 2e-05 11.3 %
:RPS:SCOP  82->332 1k1wA3  c.6.2.2 * 2e-11 22.5 %
:HMM:SCOP  3->308 1ufaA2 c.6.2.4 * 9.1e-46 29.8 %
:RPS:PFM   81->301 PF03065 * Glyco_hydro_57 3e-15 33.6 %
:HMM:PFM   87->320 PF03065 * Glyco_hydro_57 5.2e-28 27.2 224/359  
:BLT:SWISS 13->295 AMYA_PYRHO 2e-14 30.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59187.1 GT:GENE ABA59187.1 GT:PRODUCT Glycoside hydrolase, family 57 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3104405..3105589 GB:FROM 3104405 GB:TO 3105589 GB:DIRECTION + GB:PRODUCT Glycoside hydrolase, family 57 GB:PROTEIN_ID ABA59187.1 GB:DB_XREF GI:76884506 InterPro:IPR004300 LENGTH 394 SQ:AASEQ MSIIHHALVLNLHQPAGNLEHLLEHAPWEAQEILYALDRIPRSLWGYEDIARVHLAFSGTLLETLSNPGFQQRVYGIIKCGDLLWHLQNTALFNLLGSAYYHPALPLIPGPDREEHIKRWLGIGRHLFSQTRFSGFWPPEMAFTMELIPLLKQHGFRYVLVDSLHVEPLEEMSWQELRYRPHIAEYGGEEIIVVVRDRELSDAQEAGMEYDWFLNELYHRTRPCDFPPLVTTCSDGDNGGWFRNTSEESNFWGTFYRDFLTGARRDNAILRPAFIQDYLDKYGAKGRVRITTAAWNTGDHSGIDFIQWTGSQCQKEALKRVEETSTAFHQLKQKHLGAQALNPEIAHLLNEAEWHLLRSETSCHFYWGEAWVHRAHEDLDTAWTQMNTAAQKLK GT:EXON 1|1-394:0| BL:SWS:NREP 1 BL:SWS:REP 13->295|AMYA_PYRHO|2e-14|30.7|251/633| BL:PDB:NREP 1 BL:PDB:REP 1->200|1k1xA|8e-12|32.8|174/636| RP:PDB:NREP 1 RP:PDB:REP 85->182|2c1iA|2e-05|11.3|97/383| RP:PFM:NREP 1 RP:PFM:REP 81->301|PF03065|3e-15|33.6|214/349|Glyco_hydro_57| HM:PFM:NREP 1 HM:PFM:REP 87->320|PF03065|5.2e-28|27.2|224/359|Glyco_hydro_57| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03065|IPR004300| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03065|IPR004300| RP:SCP:NREP 1 RP:SCP:REP 82->332|1k1wA3|2e-11|22.5|222/293|c.6.2.2| HM:SCP:REP 3->308|1ufaA2|9.1e-46|29.8|285/412|c.6.2.4|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 27 OP:NHOMOORG 22 OP:PATTERN --1----------------------------------------------------111111------- ---------------------------------------------------------------------------------------------------------------------------------------------------1-1--1-------------211-1-----------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------1--1-----2-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 48.7 SQ:SECSTR cccEEEEEEEEEcccTTccHHHHHHHHHHTHHHHHHHTTcTTc########cEEEEEcHHHHHHHHcHHHHHHHHHHHHTTcHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHHHccccccEEccGGGcccHHHHHTcccEEEcccEEccHHHHccHHHHHHHHHHHccEEEETTEEEEEEEEcHHH################################################################################################################################################################################################## DISOP:02AL 390-394| PSIPRED ccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccEEEEEcHHHHcccccccccccccccEEEEccccEEEEEEcccHHccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcHHHHHHHccccEEEEEccccEEcccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHcc //