[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59192.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->82 2c03B PDBj 4e-04 9.2 %
:RPS:SCOP  3->65 1f2t.1  c.37.1.12 * 6e-06 30.2 %
:HMM:SCOP  1->86 1xew.1 c.37.1.12 * 5e-06 24.4 %
:HMM:PFM   2->88 PF02463 * SMC_N 1.2e-07 21.8 87/220  
:BLT:SWISS 1->65 RECF_MANSM 4e-05 24.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59192.1 GT:GENE ABA59192.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3109372..3109824) GB:FROM 3109372 GB:TO 3109824 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59192.1 GB:DB_XREF GI:76884511 LENGTH 150 SQ:AASEQ MKFDDNFNVIIGRNDVGKSTILEALEIFFNNETVKMEIGDHNVHVDDPEMSIQVSFRPEDKQYTIDTVPTDLHREYLLDENGKLTIKKSWDCSKDKLTATSLKTYIIANYPTAFEEPLISLKIADLKKLLDGYADKHVARERVAHPAISY GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->65|RECF_MANSM|4e-05|24.6|65/360| RP:PDB:NREP 1 RP:PDB:REP 7->82|2c03B|4e-04|9.2|76/297| HM:PFM:NREP 1 HM:PFM:REP 2->88|PF02463|1.2e-07|21.8|87/220|SMC_N| RP:SCP:NREP 1 RP:SCP:REP 3->65|1f2t.1|6e-06|30.2|63/288|c.37.1.12| HM:SCP:REP 1->86|1xew.1|5e-06|24.4|86/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-------------1-----------------------------------------------------1------------------------------------1------------------1---------------1-------1------------1--------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 50.7 SQ:SECSTR ######EEEEEccTTTTHHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHHHHTccEEEccTTccHHHHHHHHHHHH#################################################################### DISOP:02AL 147-149| PSIPRED cccccccEEEEEcccccHHHHHHHHHHHccccccEEEEccEEEcccccEEEEEEEEccccccEEccccHHHHHHHHEEcccccEEEEEEEcccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccc //