[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.50.3
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  22->64 1whzA  d.50.3.2 * 6e-04 31.0 %
:HMM:SCOP  18->74 1whzA_ d.50.3.2 * 0.00023 24.6 %
:HMM:PFM   22->68 PF07927 * YcfA 5.3e-09 27.7 47/58  
:HMM:PFM   4->36 PF03412 * Peptidase_C39 0.00033 21.2 33/131  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59195.1 GT:GENE ABA59195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3113077..3113319) GB:FROM 3113077 GB:TO 3113319 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59195.1 GB:DB_XREF GI:76884514 LENGTH 80 SQ:AASEQ MSKAEKLLAKMRTNPRGWRIDELETVAKRFGIDVRKTGGSHFVFLHPDSELAVTIPFKRPIKPVYVTQFLALLDDIGAEE GT:EXON 1|1-80:0| HM:PFM:NREP 2 HM:PFM:REP 22->68|PF07927|5.3e-09|27.7|47/58|YcfA| HM:PFM:REP 4->36|PF03412|0.00033|21.2|33/131|Peptidase_C39| RP:SCP:NREP 1 RP:SCP:REP 22->64|1whzA|6e-04|31.0|42/70|d.50.3.2| HM:SCP:REP 18->74|1whzA_|0.00023|24.6|57/0|d.50.3.2|1/1|YcfA/nrd intein domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1-----------1------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 78-80| PSIPRED ccHHHHHHHHHHcccccccHHHHHHHHHHHcEEEEEEcccEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHccccc //