[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59196.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->71 PF03211 * Pectate_lyase 0.00076 25.8 62/215  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59196.1 GT:GENE ABA59196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3113402..3113683 GB:FROM 3113402 GB:TO 3113683 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59196.1 GB:DB_XREF GI:76884515 LENGTH 93 SQ:AASEQ MLVVTFTILVLHEGATKYHRTLDTRNGGLRIASTGNHNGVIAEYVTKDILTDLEALNLFKIELNGSPANKAKLRNHAFVRASKFGGDMAYKRS GT:EXON 1|1-93:0| HM:PFM:NREP 1 HM:PFM:REP 8->71|PF03211|0.00076|25.8|62/215|Pectate_lyase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 92-93| PSIPRED cEEEEEEEEEEEccccHHHHccccccccEEEEEccccccEEHHHHHHHHHHHHHHcEEEEEEEcccccccHHccccEEEEEEcccccEEEccc //