[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59228.1
DDBJ      :             BolA-like protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  149/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->74 1xs3A PDBj 3e-17 50.0 %
:RPS:SCOP  1->74 1v9jA  d.52.6.1 * 5e-16 31.5 %
:HMM:SCOP  1->74 1v9jA_ d.52.6.1 * 4.1e-20 42.5 %
:RPS:PFM   9->74 PF01722 * BolA 1e-09 43.9 %
:HMM:PFM   10->74 PF01722 * BolA 4.7e-22 40.6 64/75  
:BLT:SWISS 1->72 Y3122_SYNY3 4e-11 41.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59228.1 GT:GENE ABA59228.1 GT:PRODUCT BolA-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3158123..3158350) GB:FROM 3158123 GB:TO 3158350 GB:DIRECTION - GB:PRODUCT BolA-like protein GB:PROTEIN_ID ABA59228.1 GB:DB_XREF GI:76884547 InterPro:IPR002634 LENGTH 75 SQ:AASEQ MNASEIKRMIETGLPESEVAVHSEDGHHFEALVVYEGFRGKSLLERHRMVYEALGDSFKSTLHALAIRTQLPGEG GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|Y3122_SYNY3|4e-11|41.7|72/85| BL:PDB:NREP 1 BL:PDB:REP 1->74|1xs3A|3e-17|50.0|74/80| RP:PFM:NREP 1 RP:PFM:REP 9->74|PF01722|1e-09|43.9|66/71|BolA| HM:PFM:NREP 1 HM:PFM:REP 10->74|PF01722|4.7e-22|40.6|64/75|BolA| RP:SCP:NREP 1 RP:SCP:REP 1->74|1v9jA|5e-16|31.5|73/113|d.52.6.1| HM:SCP:REP 1->74|1v9jA_|4.1e-20|42.5|73/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 159 OP:NHOMOORG 155 OP:PATTERN ---------------------------111-------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1-----11---------1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-1221111111111111111111-111111111111111111--111122--111-----11---------11111111--------------------------------1--11111111111111111111111111111111111111-----1-----11--111---------11111----------------------------------------------------------11--------------------------------11------------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------11111111111111----111111------------------------------------------------- -------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------11----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 98.7 SQ:SECSTR cHHHHHHHHHHHHccccEEEEEccTTcccEEEEEcGGGcccccHHHHHHHHHHTTcTTTTcccccEEEEEcGGG# DISOP:02AL 1-2, 72-75| PSIPRED ccHHHHHHHHHHHccccEEEEEcccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEEccccc //