[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59237.1
DDBJ      :             Protein of unknown function DUF1239
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->174 PF06835 * DUF1239 3e-17 30.9 %
:HMM:PFM   4->178 PF06835 * DUF1239 6e-45 31.8 173/176  
:BLT:SWISS 28->179 LPTC_SHIFL 1e-06 25.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59237.1 GT:GENE ABA59237.1 GT:PRODUCT Protein of unknown function DUF1239 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3164694..3165245 GB:FROM 3164694 GB:TO 3165245 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF1239 GB:PROTEIN_ID ABA59237.1 GB:DB_XREF GI:76884556 InterPro:IPR010664 LENGTH 183 SQ:AASEQ MVALMLIATLTAWELLHEESAYIPRSDLNKRTTDYFMEKFTSTLMDQQGLPLYRLAGTHMAHYLDNDTIEITAPDAVFYQQATARWKVVAERGLTNSQGDEIDLLGEVIIRQLGADSKTSNMKILTQNVRVKPRIKYAETQQPVTLLNSFGKTHSIGARVYLKDGRIELLSQVRGNYDLAPEP GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 28->179|LPTC_SHIFL|1e-06|25.7|148/191| RP:PFM:NREP 1 RP:PFM:REP 2->174|PF06835|3e-17|30.9|165/170|DUF1239| HM:PFM:NREP 1 HM:PFM:REP 4->178|PF06835|6e-45|31.8|173/176|DUF1239| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111--111111-1-1-11---1----------------111-----------1-------------------------------------------------------------------------------1---------------1111------------------------------------------------------------------------------------------------------1-1---------------------------1-11111111111111111--------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 20-30, 177-183| PSIPRED cHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcEEEEEEcccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEccccEEEEEEEEEEEEEccccEEEEEccEEEEEcccccccccEEEEEEEEEEEEcccEEEEcccEEEEcccEEEEEEEEEEEEcccEEEEEEcccEEEEccccc //