[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59241.1
DDBJ      :             SSU ribosomal protein S30P / sigma 54 modulation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  540/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.204.1
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->91 1n3gA PDBj 4e-16 40.7 %
:RPS:SCOP  1->100 1imuA  d.204.1.1 * 8e-28 35.0 %
:HMM:SCOP  1->107 1imuA_ d.204.1.1 * 1.6e-34 48.6 %
:RPS:PFM   3->94 PF02482 * Ribosomal_S30AE 1e-18 53.3 %
:HMM:PFM   2->95 PF02482 * Ribosomal_S30AE 3e-36 50.0 94/94  
:BLT:SWISS 1->99 RP5M_AZOVI 1e-31 57.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59241.1 GT:GENE ABA59241.1 GT:PRODUCT SSU ribosomal protein S30P / sigma 54 modulation protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3168317..3168643 GB:FROM 3168317 GB:TO 3168643 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S30P / sigma 54 modulation protein GB:PROTEIN_ID ABA59241.1 GB:DB_XREF GI:76884560 InterPro:IPR003489 LENGTH 108 SQ:AASEQ MQVNITGNRIEITQALRSYIENKCERLERHFDQLIHLHIVLSVEKMRQKAEATLHLSGANVVASAEDEDMYAAIDDLTDKLDRQIKKHREKLTDHRRSEGIMKKQQQG GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 1->99|RP5M_AZOVI|1e-31|57.6|99/107| BL:PDB:NREP 1 BL:PDB:REP 1->91|1n3gA|4e-16|40.7|91/113| RP:PFM:NREP 1 RP:PFM:REP 3->94|PF02482|1e-18|53.3|92/98|Ribosomal_S30AE| HM:PFM:NREP 1 HM:PFM:REP 2->95|PF02482|3e-36|50.0|94/94|Ribosomal_S30AE| GO:PFM:NREP 2 GO:PFM GO:0005488|"GO:binding"|PF02482|IPR003489| GO:PFM GO:0044238|"GO:primary metabolic process"|PF02482|IPR003489| RP:SCP:NREP 1 RP:SCP:REP 1->100|1imuA|8e-28|35.0|100/107|d.204.1.1| HM:SCP:REP 1->107|1imuA_|1.6e-34|48.6|107/107|d.204.1.1|1/1|Ribosome binding protein Y (YfiA homologue)| OP:NHOMO 661 OP:NHOMOORG 542 OP:PATTERN -------------------------------------------------------------------- 1-1-------------------------------------------------------------------------------1----1------------------------------------1---------------------111111111111111-11111111111111111111111-111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111-1----------------------------------------------------------------1--------1---------------------------------------------------111-111111111111111111111111111111111111111111111111111111-------111111--11-1-11--111111111111111111-111--1------1-------------111222111211222222223322223233222--11111------22222222222222122-2222222222222222222222222222222222222222222212222222-212122212222--11111111111111111111-1111111111------111111111111111111111111111111111222122222222221111111111111111------------------1---------------------------1111-1-11-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 91.7 SQ:SECSTR cccEEccccccccHHHHHHHHHHHHHHTTccccccEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccc######### DISOP:02AL 90-108| PSIPRED cEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //