[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59245.1
DDBJ      :             PTS system fructose subfamily IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  238/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.54.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->124 3iprC PDBj 1e-11 28.1 %
:RPS:PDB   5->127 3bedA PDBj 3e-19 24.8 %
:RPS:SCOP  5->126 3bedA1  c.54.1.1 * 4e-19 24.6 %
:HMM:SCOP  2->128 1pdoA_ c.54.1.1 * 1e-24 31.7 %
:RPS:PFM   3->102 PF03610 * EIIA-man 8e-13 35.4 %
:HMM:PFM   3->103 PF03610 * EIIA-man 1e-22 29.0 100/116  
:BLT:SWISS 1->124 PTNAB_SHIFL 9e-11 31.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59245.1 GT:GENE ABA59245.1 GT:PRODUCT PTS system fructose subfamily IIA component GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3170597..3171004 GB:FROM 3170597 GB:TO 3171004 GB:DIRECTION + GB:PRODUCT PTS system fructose subfamily IIA component GB:PROTEIN_ID ABA59245.1 GB:DB_XREF GI:76884564 InterPro:IPR004701 LENGTH 135 SQ:AASEQ MTVGVLIITHGNIGSSLLDTTNDMLGSCPLQLKILRVTRASHPDALRQQTKEMINCLNTGQGVLILTDMYGSTPSNIACYAADEQQVRVVTGLNLPMLIRVLNYPFLSLTKLAEKAISGGREGVYTCLTTNEGTE GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 1->124|PTNAB_SHIFL|9e-11|31.7|123/323| BL:PDB:NREP 1 BL:PDB:REP 3->124|3iprC|1e-11|28.1|121/139| RP:PDB:NREP 1 RP:PDB:REP 5->127|3bedA|3e-19|24.8|113/121| RP:PFM:NREP 1 RP:PFM:REP 3->102|PF03610|8e-13|35.4|99/117|EIIA-man| HM:PFM:NREP 1 HM:PFM:REP 3->103|PF03610|1e-22|29.0|100/116|EIIA-man| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03610|IPR004701| GO:PFM GO:0016021|"GO:integral to membrane"|PF03610|IPR004701| RP:SCP:NREP 1 RP:SCP:REP 5->126|3bedA1|4e-19|24.6|118/132|c.54.1.1| HM:SCP:REP 2->128|1pdoA_|1e-24|31.7|126/129|c.54.1.1|1/1|IIA domain of mannose transporter, IIA-Man| OP:NHOMO 241 OP:NHOMOORG 238 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1----------------------------------1-1111----------------------1-------------------------------------------------------------------------2-------1-------11------2--------------11--1-----1111-1111-11--1111111111111111111-111111111-1-111111111111111-1---1-11------------11-1111------------------------------111111111111111111111111111111111111111111111111-111111111111111111111111111-111-111111111-11111--1111111-11------------------------------------------------------------1-11-----------1-11-1111111-1-111-11-1121111111---1111--1---------------1111111--------------1-1-----------------------------------------------------------------------------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 94.1 SQ:SECSTR ccEEEEEEEETTHHHHHHHHcccHHEEHcTTcccEEEEcTTTHHHHHHHHHHHHHHcHHccccEEEEEccTcHHHHHHHTHTTcTTEEEEEcccHHHHHHHHcccHccHHHHHHHHHHHHHHTcccc######## DISOP:02AL 130-135| PSIPRED ccEEEEEEEcHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHEEEcccccccc //