[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59250.1
DDBJ      :             Nucleoside/H+ symporter, Major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  221/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:384 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->321 1pv6A  f.38.1.2 * 2e-17 13.8 %
:HMM:SCOP  1->384 1pv7A_ f.38.1.2 * 3e-43 25.0 %
:RPS:PFM   12->312 PF03825 * Nuc_H_symport 3e-15 29.7 %
:HMM:PFM   13->354 PF03825 * Nuc_H_symport 3.4e-24 24.0 342/400  
:BLT:SWISS 11->320 HCAT_ECOLI 1e-24 28.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59250.1 GT:GENE ABA59250.1 GT:PRODUCT Nucleoside/H+ symporter, Major facilitator superfamily MFS_1 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3175927..3177081 GB:FROM 3175927 GB:TO 3177081 GB:DIRECTION + GB:PRODUCT Nucleoside/H+ symporter, Major facilitator superfamily MFS_1 GB:PROTEIN_ID ABA59250.1 GB:DB_XREF GI:76884569 InterPro:IPR004740 InterPro:IPR007114 InterPro:IPR011701 LENGTH 384 SQ:AASEQ MQTKTPTPPYWRLSGFYLFYFATLGALLPYWGLYLQSLGFAPQKIGELMALLMATRVLAPNIWGYIADHSGKRMIIVRMASLLAALAFSAVYLNHDYWTLAGIMVIFSFFWNGTLAQVEVTTLTHLGKKTHHYSRIRLWGSVGFILSVALLGATLDRTSIDLLPTVILILMTSIWLMSLTVPESNINLPRKDCGSLWGVLQKPEVLTFFAATFLMQASHGPYYTFYTIYMEGYGYSRSLIGYLWALGVIAEVGLFLTMHRLLPTLGVRWMLLGSLLLASLRWLLVGLFPTQFSLMVFAQLLHAATFGSFHAAAIDWIHHRFTGIHQGRGQALYSSLGFGAGGAFGSFYSGQLWAMEPRSAYLAAAVIGIAAFCLAYPTINRPPR GT:EXON 1|1-384:0| BL:SWS:NREP 1 BL:SWS:REP 11->320|HCAT_ECOLI|1e-24|28.4|306/379| TM:NTM 8 TM:REGION 15->37| TM:REGION 96->118| TM:REGION 137->159| TM:REGION 161->183| TM:REGION 238->260| TM:REGION 273->295| TM:REGION 330->351| TM:REGION 360->381| SEG 80->90|asllaalafsa| SEG 121->132|ttlthlgkkthh| SEG 268->287|rwmllgslllaslrwllvgl| SEG 331->350|alysslgfgaggafgsfysg| SEG 360->375|aylaaavigiaafcla| RP:PFM:NREP 1 RP:PFM:REP 12->312|PF03825|3e-15|29.7|293/389|Nuc_H_symport| HM:PFM:NREP 1 HM:PFM:REP 13->354|PF03825|3.4e-24|24.0|342/400|Nuc_H_symport| GO:PFM:NREP 3 GO:PFM GO:0005337|"GO:nucleoside transmembrane transporter activity"|PF03825|IPR004740| GO:PFM GO:0015858|"GO:nucleoside transport"|PF03825|IPR004740| GO:PFM GO:0016021|"GO:integral to membrane"|PF03825|IPR004740| RP:SCP:NREP 1 RP:SCP:REP 10->321|1pv6A|2e-17|13.8|311/417|f.38.1.2| HM:SCP:REP 1->384|1pv7A_|3e-43|25.0|380/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 227 OP:NHOMOORG 223 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------1-------------1-------1-------------------------------------------------------------------------------------------------------------------1-------------1-----1-------------------11---1-1------------------------1-1---11-111--1---------------------------1-1-----------------------------------1----------------------------111111------------1---111111----------1111-1-1----------------------------1-------------------11111111111111-1-11111111111111111121---1111------111111-1111111111-111111111111111111111111111111111111111111111111111--111111111111-------------111-1111-1111111111-11111-1---1122121111111111111---------11111111111111111--------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 180-197, 383-384| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //