[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59258.1
DDBJ      :             Heat shock protein Hsp70
Swiss-Prot:DNAK_NITOC   RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70;

Homologs  Archaea  27/68 : Bacteria  912/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
a.8.4b.130.1c.55.1d.58.21e.39.1
:640 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->600 2khoA PDBj 0.0 73.7 %
:RPS:PDB   3->369 1dkgD PDBj 2e-90 79.0 %
:RPS:PDB   395->552 1bprA PDBj 1e-47 74.7 %
:RPS:PDB   534->600 1dg3A PDBj 6e-04 26.2 %
:RPS:SCOP  81->328 1mw7A  e.39.1.1 * 3e-47 16.2 %
:RPS:SCOP  321->369 1ekrA  d.58.21.1 * 6e-10 14.3 %
:RPS:SCOP  395->540 3c7nB1  b.130.1.1 * 3e-52 60.3 %
:HMM:SCOP  1->184 1hjoA1 c.55.1.1 * 4.5e-66 58.5 %
:HMM:SCOP  186->383 1dkgD2 c.55.1.1 * 1.3e-68 49.0 %
:HMM:SCOP  383->540 1ckrA_ b.130.1.1 * 1e-59 61.4 %
:HMM:SCOP  507->603 1dkzA1 a.8.4.1 * 5.3e-21 34.0 %
:RPS:PFM   6->497 PF00012 * HSP70 e-148 66.0 %
:HMM:PFM   4->603 PF00012 * HSP70 1.7e-267 64.5 594/602  
:BLT:SWISS 1->604 DNAK_NITOC 0.0 100.0 %
:PROS 7->14|PS00297|HSP70_1
:PROS 192->205|PS00329|HSP70_2
:PROS 337->351|PS01036|HSP70_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59258.1 GT:GENE ABA59258.1 GT:PRODUCT Heat shock protein Hsp70 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3186828..3188750) GB:FROM 3186828 GB:TO 3188750 GB:DIRECTION - GB:PRODUCT Heat shock protein Hsp70 GB:PROTEIN_ID ABA59258.1 GB:DB_XREF GI:76884577 InterPro:IPR001023 LENGTH 640 SQ:AASEQ MGKIIGIDLGTTNSCVALMEGNKPRVIENAEGDRTTPSVVAFTKEGETLVGQSAKRQAITNPQNTLYAIKRLIGRRFDEEVVQRDIKMVPYKIVKADNGDAWVEATGKKMAPPEVSANVLRKMKKTAEDYLGEEVEAAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKKRGDQKIAVYDLGGGTFDVSIIEIAEVEGEHQFEVLSTNGDTFLGGEDFDKRIIDYIAEEFKKEQSIDLRGDPLAMQRLKDAAEKAKIELSSSQQTEVNLPYVTADASGPKHLNVRITRAKLESLVEDLINRTIGPCKTALQDAKLSASDIDEVILVGGQTRMPKVQEAAKEFFGKEPRKDVNPDEAVAVGAAIQAGVLGGEVKEVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTRKTQVFSTAEDNQTAVTVHVLQGEREQAVGNKSLGRFDLVGIPPAHRGMPQIEVTFDIDANGILNVSAKDKATGKEQSIVIKASSGLAEGEIERMVSDAEAHVEEDRKFRELVDLRNQGDNLIHATEKSMEELGDKLEANEKSEIEKTIGELKTAMKEDNKEVIEARIKDLTDASAKMAERLYTQQAEEPQPQKEEGKAAEEDVVDAEFEEVKEDKNKAS GT:EXON 1|1-640:0| SW:ID DNAK_NITOC SW:DE RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70; SW:GN Name=dnaK; OrderedLocusNames=Noc_2811; SW:KW ATP-binding; Chaperone; Complete proteome; Nucleotide-binding;Phosphoprotein; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->604|DNAK_NITOC|0.0|100.0|604/640| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 7->14|PS00297|HSP70_1|PDOC00269| PROS 192->205|PS00329|HSP70_2|PDOC00269| PROS 337->351|PS01036|HSP70_3|PDOC00269| SEG 370->394|avavgaaiqagvlggevkevllldv| SEG 605->635|qqaeepqpqkeegkaaeedvvdaefeevked| BL:PDB:NREP 1 BL:PDB:REP 4->600|2khoA|0.0|73.7|597/600| RP:PDB:NREP 3 RP:PDB:REP 3->369|1dkgD|2e-90|79.0|362/376| RP:PDB:REP 395->552|1bprA|1e-47|74.7|158/173| RP:PDB:REP 534->600|1dg3A|6e-04|26.2|61/540| RP:PFM:NREP 1 RP:PFM:REP 6->497|PF00012|e-148|66.0|479/488|HSP70| HM:PFM:NREP 1 HM:PFM:REP 4->603|PF00012|1.7e-267|64.5|594/602|HSP70| RP:SCP:NREP 3 RP:SCP:REP 81->328|1mw7A|3e-47|16.2|216/220|e.39.1.1| RP:SCP:REP 321->369|1ekrA|6e-10|14.3|49/143|d.58.21.1| RP:SCP:REP 395->540|3c7nB1|3e-52|60.3|146/154|b.130.1.1| HM:SCP:REP 1->184|1hjoA1|4.5e-66|58.5|183/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 186->383|1dkgD2|1.3e-68|49.0|198/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 383->540|1ckrA_|1e-59|61.4|158/159|b.130.1.1|1/1|Heat shock protein 70kD (HSP70), peptide-binding domain| HM:SCP:REP 507->603|1dkzA1|5.3e-21|34.0|97/97|a.8.4.1|1/1|Heat shock protein 70kD (HSP70), C-terminal subdomain| OP:NHOMO 4198 OP:NHOMOORG 1137 OP:PATTERN ------------------------11121111111-------12211211212--------111--11 2241211222221112211-11112111111211112273276911111111321121112211338212111111111121111111221111111111111111121211111111111111211122111222323221112144554443343222322444254542222222222221111111121122222122121111122111112211111212222232211111111111111111111111111112221111111211111111111111111111111111111111111111111111111111122242111111121112AA33331121112211223214221121211141121113111111111221112112111111111111221232121111211211211111221111111111111222222221112121122222222222222122222222222222112121322223233332222233422222223463433223343232255333233422223222322221113331322111111211112122113139989D612111111111111111111111111222232111312222222222222222222223111212222222224222213333323232-33433223223233333332222322232323233333232222332223311222222222222111211111111131214222222222222222222321322222222233432222223331111111111332322222222222111111111111122211111112222222211111111-11111111111111111111111111111111 5555D791UDC366877966777787777577777777785777778777677979788777A9999969BCB8CLE8GE99999998-7C7787A9987696BCI38LPFIMNJKEBBAE8BANHBQ9**G1JHT9AA8LBCEBACB8AC88PBEBCEBFO9OFABR8-C9DA969C8*787B9OUac7LH9BIIJN9 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- STR:NPRED 604 STR:RPRED 94.4 SQ:SECSTR ccEEEEEEEcccEEEEEEEETTEEEEcccTTccccEEccEEEcEcccEEETHHHHHHTTTcGGGEEccGGGcTTccTTcTTHHHHHTTcccEEEEcTTccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEEEEHHHHHHHHHHHHccccccTEEEEEEccccEEEEEEEEcHHTETTEEEEEEEEEEccccHHHHHHHHHHHHHHHTTcccccccTTcHHHHHHHHHHHHHHHHHHTTccEEEEEEcccETcccTTccEEEEEEHHHHHHHHTTGGGccHHHHHHHHHHTTccGGGccEEEEEcGGGGcHHHHHHHHHHHTccEEccccTTTHHHHHHHHHHTcTTccccccEEEEEEcccEEEEEccccEEEEEcTTEEEcEEEEEEEcccccEEEEEEEccGGGccTTcTcccEEEEEEEEcccccccccEcEEEEEEEcTTccEEEEEEEEEEEEEccEEEccccccccccccEEHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTTcTTTcccTTTTTccccHHHHHHGGGcTTccccHHHHHHHHHHHHHHHHHHHH#################################### DISOP:02AL 490-531, 600-630, 632-640| PSIPRED cccEEEEEEcccEEEEEEEEccEEEEEEcccccccccEEEEEcccccEEEcHHHHHHHHcccccEEEEcHHHHccccccHHHHHHHHHcccEEEEccccEEEEEEcccEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccccccEEEEEEEccccEEEEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccEEEEcEEEEEEEEEEEcccEEEEEEcccccccEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEcccccccccccEEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc //