[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59290.1
DDBJ      :             ribosomal large subunit pseudouridine synthase C
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  902/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   100->315 1xpiB PDBj 1e-58 53.5 %
:RPS:PDB   22->314 3dh3B PDBj 7e-24 17.2 %
:RPS:SCOP  22->117 1dm9A  d.66.1.3 * 2e-09 12.4 %
:RPS:SCOP  100->315 1v9kA  d.265.1.3 * 1e-54 53.0 %
:HMM:SCOP  23->80 1vioA2 d.66.1.5 * 2.5e-07 26.3 %
:HMM:SCOP  96->321 1v9kA_ d.265.1.3 * 1.2e-56 39.6 %
:RPS:PFM   105->253 PF00849 * PseudoU_synth_2 5e-18 42.8 %
:HMM:PFM   105->254 PF00849 * PseudoU_synth_2 1.3e-28 32.7 150/164  
:HMM:PFM   24->70 PF01479 * S4 7.8e-10 29.8 47/48  
:BLT:SWISS 12->314 RLUC_PASMU 1e-82 53.3 %
:PROS 143->157|PS01129|PSI_RLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59290.1 GT:GENE ABA59290.1 GT:PRODUCT ribosomal large subunit pseudouridine synthase C GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3221119..3222093 GB:FROM 3221119 GB:TO 3222093 GB:DIRECTION + GB:PRODUCT ribosomal large subunit pseudouridine synthase C GB:PROTEIN_ID ABA59290.1 GB:DB_XREF GI:76884609 InterPro:IPR002942 InterPro:IPR006145 InterPro:IPR006224 InterPro:IPR006225 LENGTH 324 SQ:AASEQ MNTAKKPPAAQVRILKIHLEQAGQRIDNFLFSQLKGVPKSRIYRCLRKGEVRVNKSRIASSYRLQQGDQVRVPPLRVSHSPLKRPIAHSLLLLIKNSLLYEDKELLMLNKPARIPVHGGSGVSYGIIEALRILRPEAAFLELVHRLDRETSGCLMVAKTRSALLTLQAMQQKQLIHKRYLALVKGRWRKNVQRVDLPLLKNILRSEERIVKVNSAGKPAISHFYPKLFYGGEATLMEVTLETGRTHQIRVHAAHLGHPLGGDEKYGDSSFNKQLRCMGLHRLFLHASQLTFTLPEGKKTIKAAAPLPKELNAVLQTYAAKLRAK GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 12->314|RLUC_PASMU|1e-82|53.3|300/326| PROS 143->157|PS01129|PSI_RLU|PDOC00869| SEG 90->99|lllliknsll| BL:PDB:NREP 1 BL:PDB:REP 100->315|1xpiB|1e-58|53.5|215/229| RP:PDB:NREP 1 RP:PDB:REP 22->314|3dh3B|7e-24|17.2|239/241| RP:PFM:NREP 1 RP:PFM:REP 105->253|PF00849|5e-18|42.8|145/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 105->254|PF00849|1.3e-28|32.7|150/164|PseudoU_synth_2| HM:PFM:REP 24->70|PF01479|7.8e-10|29.8|47/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 22->117|1dm9A|2e-09|12.4|89/104|d.66.1.3| RP:SCP:REP 100->315|1v9kA|1e-54|53.0|215/227|d.265.1.3| HM:SCP:REP 23->80|1vioA2|2.5e-07|26.3|57/58|d.66.1.5|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 96->321|1v9kA_|1.2e-56|39.6|225/0|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2914 OP:NHOMOORG 1088 OP:PATTERN --------------------------------------11111------------------------- 2121131222221211111-11111211111111112111111111211111111211111111111111111111112111111222444414-311122223234424-2222222-211114111111111112221111131223232311223212312212222112111112111132311221433-3333333333333322333333333333223333334523333333333333333333-343443433344444444433333333323333333333333333333333333333333223332223323333333333333433333333343323321331411212122231332-4333322222333323333332222222222223-3233333322322332222222223334333232223333333333333333342222222222211222222222222221222333332222222232222222222222222222222222222243535433332333322244333333422225461323362233221233333432476779324333333333333333333334333322666544646745888889966688-988892-3233322222244444554444444444-44444444444444444445554444544444444444444445444444431544444444444222422222222233535555455454554444444344424436333333333-33333332222222226777566666557664433333333222222444422222223222242211112-22212212222222211122222222222242 12--121-411122211--1111111111111--1-111111111111111111111-111122222211332222221222222211-12112221-1111131-11424323243-212131331224A3-32312214234223111322333233-133422-4112-1112321E754113235-427652324 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 98.1 SQ:SECSTR #HHHTcccccccEEcHHHHHHccEEHHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEETccccccEEEEEEEcccEEEEEcTTcccccccccTTcHHTcHHHHHTcccccEEccccccccEEEEEEEccTHHHHHHEEHcGGGcccEEEEEEEcccccHHHHHHEEEEEEEEEEcHHHHHHHHTccccccccccccEEEEccccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEEEEEEEETTEEEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccTHHHH##### DISOP:02AL 1-15, 322-324| PSIPRED cccccccccccEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHcccEEEccEEEccccEEccccEEEEEcccccccccccccccccHHHHHHHHHHcccEEEEEEccccEEEEcccccccHHHHHHHHHccccccEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEEEccccEEEEEcccccccccccEEEEEcccccccccEEEEEEEEcccEEEEEEEEcccccHHHHHHHHHcccEEEccccccccccccccccccccccEEEEEEEEEEccccccEEEEEccccHHHHHHHHHHccccccc //