[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59298.1
DDBJ      :             Peptidase M23B
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  717/915 : Eukaryota  6/199 : Viruses  13/175   --->[See Alignment]
b.71.1b.84.3
:315 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   201->307 2gu1A PDBj 6e-19 43.0 %
:RPS:PDB   192->311 2b0pA PDBj 1e-27 30.8 %
:RPS:SCOP  212->306 2fhbA4  b.71.1.1 * 4e-27 11.6 %
:HMM:SCOP  141->309 1qwyA_ b.84.3.2 * 3.3e-50 43.8 %
:RPS:PFM   211->301 PF01551 * Peptidase_M23 3e-22 47.3 %
:HMM:PFM   211->305 PF01551 * Peptidase_M23 3.5e-33 51.6 95/96  
:BLT:SWISS 82->123 DFA4_ANASP 7e-04 38.1 %
:BLT:SWISS 201->306 YEBA_SHIFL 2e-22 52.4 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59298.1 GT:GENE ABA59298.1 GT:PRODUCT Peptidase M23B GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3230951..3231898) GB:FROM 3230951 GB:TO 3231898 GB:DIRECTION - GB:PRODUCT Peptidase M23B GB:PROTEIN_ID ABA59298.1 GB:DB_XREF GI:76884617 InterPro:IPR002886 LENGTH 315 SQ:AASEQ MDIIILPKASRSRNCIHLGTRAFFACLFLILTFLLLTVYGAYHFGMRTQFTVQQESLAQMQVLTKDWQARLERQQAMLAATTKQAEEGLGVLAQRLGYLQANVIRLNALGQRLIVYADLEQGEFDFTHPPAMGGPESRIGEIPKLSDFLATMEQLAQEITDRQQQLRLLETMLLEWDIQQAALPAGRPLHQGWLSSKYGYRTDPFNGRREFHNGVDFAGKAGTKILAVAAGIVTWVGKRSGYGRMVEINHGNGYVTRYAHNRKNLVQVGEHIVKGQVIALMGSSGRSTGPHVHLEVLHEGRTVDPLQFVRAVEDS GT:EXON 1|1-315:0| BL:SWS:NREP 2 BL:SWS:REP 82->123|DFA4_ANASP|7e-04|38.1|42/575| BL:SWS:REP 201->306|YEBA_SHIFL|2e-22|52.4|105/440| COIL:NAA 7 COIL:NSEG 1 COIL:REGION 78->84| TM:NTM 1 TM:REGION 20->42| SEG 22->37|affaclfliltflllt| BL:PDB:NREP 1 BL:PDB:REP 201->307|2gu1A|6e-19|43.0|107/324| RP:PDB:NREP 1 RP:PDB:REP 192->311|2b0pA|1e-27|30.8|120/129| RP:PFM:NREP 1 RP:PFM:REP 211->301|PF01551|3e-22|47.3|91/96|Peptidase_M23| HM:PFM:NREP 1 HM:PFM:REP 211->305|PF01551|3.5e-33|51.6|95/96|Peptidase_M23| RP:SCP:NREP 1 RP:SCP:REP 212->306|2fhbA4|4e-27|11.6|95/118|b.71.1.1| HM:SCP:REP 141->309|1qwyA_|3.3e-50|43.8|169/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 2370 OP:NHOMOORG 736 OP:PATTERN -------------------------------------------------------------------- 112-131322211111111-141111111111212267991--1-2112351544112--422-223775-------------3-411764625112--1222332112----------------1213133313322221---32K634564433312233233568864-3-----3----43222222-1-444454333534443321111443111413521111-73111313213211112---1-2----------------------12-111-----------------------------------------4531-22222221214-11-343215-1721647545445426675531-33-433412121223333333333333333333334-334434342451322233333333324453111111112-------------33411----------2222222221221212226634355556666666245544456555536643243322222334443233444432444442222222343344433324345525545353143434445463311223333332333333333333222116523446454466666656756666667651-2434311----45333434434444544-4544444445444444444545333334444444444444444444344443143333333333322352322243331353512123223322333233333321114566664544544445444---------3556676676766445555655555453521449988773333333345--------------------------1111111111--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------6--1--1--1---- -1--------------------------------------------------------------------------------1---------------------11--11--11--------1---1-------111-------------------------------------- STR:NPRED 140 STR:RPRED 44.4 SQ:SECSTR ###############################################################################################################################################################################ccHHHHHHHHHHcccTHHHHTccEEEccEEcTTccEEccEEEEccTTcEEEccccEEEEEEEETTTTEEEEEEEETTcEEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEEcccEEccHHHHHHEccc DISOP:02AL 67-96, 98-100, 126-159, 162-182, 314-315| PSIPRED cEEEEEEccccEEEEEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccEEEcccccEEccccccccccEEEEEcccccccEEEccccEEEEEEEccccEEEEEEEEcccEEEEEEEccccccccccEEccccEEEEEcccccccccEEEEEEEEccEEEccHHHHcccccc //