[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59308.1
DDBJ      :             Cell cycle protein, FtsW
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  862/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:384 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->374 PF01098 * FTSW_RODA_SPOVE 6e-54 41.3 %
:HMM:PFM   25->373 PF01098 * FTSW_RODA_SPOVE 6.2e-104 42.9 345/359  
:BLT:SWISS 101->374 FTSW_BUCAI 5e-62 48.5 %
:PROS 331->355|PS00428|FTSW_RODA_SPOVE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59308.1 GT:GENE ABA59308.1 GT:PRODUCT Cell cycle protein, FtsW GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3241031..3242185) GB:FROM 3241031 GB:TO 3242185 GB:DIRECTION - GB:PRODUCT Cell cycle protein, FtsW GB:PROTEIN_ID ABA59308.1 GB:DB_XREF GI:76884627 InterPro:IPR001182 LENGTH 384 SQ:AASEQ MLNRFLSTRQAARGSVSQPDLYLLGAALALAGLGWVMVGSASLAIADGPRFLWRQGIFLLMGLAAAFVVWRIRLIFWERFGPVLLLFGLGLLLLVLMPGIGVEANGSRRWLAIGPISLQPSELVKLFMVVYFSGYLVRRSYEVRTTVRGFFFPVGVLTLVGLLLLLEPDFGAVVILFATMLGMLFLGGARLWYFVLLAAIGGVGLAALAWGSPYRMERLTSFLDPWSDPLDSGYQLTQALIAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELGLVGSLAVIALFTVLVYRALLIGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMSAGGSSIIVTCIAVALILRVDLETRFPKTARRGIK GT:EXON 1|1-384:0| BL:SWS:NREP 1 BL:SWS:REP 101->374|FTSW_BUCAI|5e-62|48.5|274/399| PROS 331->355|PS00428|FTSW_RODA_SPOVE|PDOC00352| TM:NTM 9 TM:REGION 20->42| TM:REGION 50->71| TM:REGION 82->103| TM:REGION 112->134| TM:REGION 155->177| TM:REGION 192->214| TM:REGION 276->298| TM:REGION 313->335| TM:REGION 347->369| SEG 23->34|llgaalalaglg| SEG 80->99|fgpvlllfglgllllvlmpg| SEG 149->166|gfffpvgvltlvglllll| SEG 196->211|llaaiggvglaalawg| RP:PFM:NREP 1 RP:PFM:REP 36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 25->373|PF01098|6.2e-104|42.9|345/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1741 OP:NHOMOORG 864 OP:PATTERN -------------------------------------------------------------------- 2232322222222222222-222222222222222223332333-1132222222112222232111434211111113333321222222221222--212222222131111111222111112122222222133344---322222222222222222211222222221122222-22211112223343343444554445544366424443335322555555331222222222222223222222322222222221122212222322111222212222222222222111111111111-22222222222443444444443433233333333323333224434322223333212222-222211111111111111111111111111111-111111111121111111111111112222222222222222222222222222222--------2222222222222222121222122222222222222222222222222222222222222222222222222222222222211111112222222222222222222222222222222222222212221-----121222222212112222222222222222222223222222322221-2122211-11122222222222222222-22322222222221222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222221111111112333222222332223322222222222221222222222221211122--------------------------2222111111221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 374-384| PSIPRED ccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //