[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59322.1
DDBJ      :             HupE/UreJ protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->192 PF04955 * HupE_UreJ 1e-11 35.7 %
:HMM:PFM   10->191 PF04955 * HupE_UreJ 2.5e-60 58.1 179/180  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59322.1 GT:GENE ABA59322.1 GT:PRODUCT HupE/UreJ protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3257240..3257824) GB:FROM 3257240 GB:TO 3257824 GB:DIRECTION - GB:PRODUCT HupE/UreJ protein GB:PROTEIN_ID ABA59322.1 GB:DB_XREF GI:76884641 InterPro:IPR007038 LENGTH 194 SQ:AASEQ MKTKKYLSILALLLFSSIALAHPGHTEHDFSGFISGLLHPLTGLDHLLAMFAVGLWAAQQQGKARLVVPATFILAMLFAGLSAAYLGITLPFVENAIAVSVLALGLLVALAIRLPLFVAILGTALFAVNHGYAHGVEIPVLASPAGFAMGFVLATMALHAIGFGLVSFLPPRFAPLVRMLGTCSAGAGLWLLAS GT:EXON 1|1-194:0| TM:NTM 5 TM:REGION 6->24| TM:REGION 33->55| TM:REGION 65->87| TM:REGION 101->123| TM:REGION 141->163| SEG 7->21|lsilalllfssiala| SEG 36->48|gllhpltgldhll| SEG 96->116|aiavsvlalgllvalairlpl| RP:PFM:NREP 1 RP:PFM:REP 22->192|PF04955|1e-11|35.7|168/183|HupE_UreJ| HM:PFM:NREP 1 HM:PFM:REP 10->191|PF04955|2.5e-60|58.1|179/180|HupE_UreJ| OP:NHOMO 44 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----3--11----1----1-------------------------------------------------------------------------------------------1---------------------1--------------------------------------------------------------------------------1----1-11111---111111--11----1------------------------------------------------------------------------------------------------------------12-----------------------1-1-1111---11----1111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //