[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59339.1
DDBJ      :             General secretion pathway protein G
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  265/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->143 2kepA PDBj 2e-24 54.1 %
:RPS:SCOP  43->143 1oqvA  d.24.1.2 * 3e-20 17.9 %
:HMM:SCOP  39->144 1t92A_ d.24.1.3 * 6.6e-37 52.9 %
:RPS:PFM   44->135 PF08334 * GSPII_G 4e-23 57.8 %
:HMM:PFM   36->143 PF08334 * GSPII_G 5.5e-41 54.7 106/108  
:HMM:PFM   13->30 PF07963 * N_methyl 2.6e-08 72.2 18/20  
:BLT:SWISS 35->143 GSPG_PSEAE 8e-26 53.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59339.1 GT:GENE ABA59339.1 GT:PRODUCT General secretion pathway protein G GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3270740..3271174) GB:FROM 3270740 GB:TO 3271174 GB:DIRECTION - GB:PRODUCT General secretion pathway protein G GB:PROTEIN_ID ABA59339.1 GB:DB_XREF GI:76884658 InterPro:IPR000983 InterPro:IPR010054 LENGTH 144 SQ:AASEQ MQLKKVSPAGSFGFTLIELLVVLVILGLLAGLIGPQVMKYLGSAKTDSARLQIEDLAATLDLYRLEVGRYPSTEEGLQALVEAPPGATRWNGPYLKKKQVPVDPWGYEYHYRSPGEHGAFDIYSLGADNSEGGEGEDQDIVSWK GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 35->143|GSPG_PSEAE|8e-26|53.3|107/142| TM:NTM 1 TM:REGION 11->33| SEG 16->34|liellvvlvilgllaglig| BL:PDB:NREP 1 BL:PDB:REP 44->143|2kepA|2e-24|54.1|98/110| RP:PFM:NREP 1 RP:PFM:REP 44->135|PF08334|4e-23|57.8|90/102|GSPII_G| HM:PFM:NREP 2 HM:PFM:REP 36->143|PF08334|5.5e-41|54.7|106/108|GSPII_G| HM:PFM:REP 13->30|PF07963|2.6e-08|72.2|18/20|N_methyl| RP:SCP:NREP 1 RP:SCP:REP 43->143|1oqvA|3e-20|17.9|84/171|d.24.1.2| HM:SCP:REP 39->144|1t92A_|6.6e-37|52.9|104/0|d.24.1.3|1/1|Pili subunits| OP:NHOMO 334 OP:NHOMOORG 265 OP:PATTERN -------------------------------------------------------------------- --1--------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1--1111-----111221---1--1--------------2-21---1--1-----1------1122------------------11111----------------------------------111-1---11111121111111111112112111112--11421211211112---22121--------2123111121-----12----1111111--11-11-21----------------------1-1--1211211-2111111111111111111121---1111------1-12--11111122212-111111211112121122111111-------------------1111------211111111111--11-----1111111-----------------1111111---2133333123122231121---------11111111111111122222221111111--1------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 74.3 SQ:SECSTR ##################################ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccTTHHHHHHHcccccccccccTTccc##cccccTTcccEEEccccccccEEEEccTTcccccccccccEEEc# DISOP:02AL 1-8| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccEEEccccccccccccEEEccccccccEEEEEcccccccccccccccccccc //