[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59352.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->84 PF06066 * SepZ 0.00087 24.3 37/99  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59352.1 GT:GENE ABA59352.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3286352..3286702) GB:FROM 3286352 GB:TO 3286702 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59352.1 GB:DB_XREF GI:76884671 LENGTH 116 SQ:AASEQ MFRRFILLIKQAADRLNMVAKFWIVDLPEYGQINFIGQQQIVQRQADPVQGSQIDITLQRQVDIRAGAVAAQGTGAVQSCAADRREPRQHLANILPLLPGEAVAGHCPAAFNSARR GT:EXON 1|1-116:0| SEG 66->78|agavaaqgtgavq| HM:PFM:NREP 1 HM:PFM:REP 48->84|PF06066|0.00087|24.3|37/99|SepZ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 113-116| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHEEEccccccEEEEcHHHHHHHccccccccEEEEEEEcEEccccccEEcccccHHHHHHHHHccHHHHHHHHHcccccccccccccHHHccccc //