[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59356.1
DDBJ      :             Protein of unknown function DUF45
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  405/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   123->210 3cqbB PDBj 3e-09 15.9 %
:RPS:PFM   26->229 PF01863 * DUF45 8e-45 46.2 %
:HMM:PFM   25->231 PF01863 * DUF45 3.7e-66 35.3 204/205  
:PROS 193->202|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59356.1 GT:GENE ABA59356.1 GT:PRODUCT Protein of unknown function DUF45 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3291121..3291834 GB:FROM 3291121 GB:TO 3291834 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF45 GB:PROTEIN_ID ABA59356.1 GB:DB_XREF GI:76884675 InterPro:IPR002725 InterPro:IPR006025 LENGTH 237 SQ:AASEQ MAVPKPEYRDGNGFIAEVIRTDRRKTAGIRIEDGAVSVLIPATLPIERVDALLKAKRQWIKEKIVLHQQARPVSQKQFVSGEAFSYLGRNYRLKVEKGAFQSVKLLNGRLLVTNPKGKDQPQMIRHALVRWYRRQADQKLKEKVKRFAPVVGVQPAGMGIKTFKSRWGSCTAKGRLEFNWRIMMAPNRCVDYVVVHELCHLIRHDHSPEFWQAIARIMPDYRQCREWLRENASQLRV GT:EXON 1|1-237:0| PROS 193->202|PS00142|ZINC_PROTEASE|PDOC00129| RP:PDB:NREP 1 RP:PDB:REP 123->210|3cqbB|3e-09|15.9|88/94| RP:PFM:NREP 1 RP:PFM:REP 26->229|PF01863|8e-45|46.2|195/198|DUF45| HM:PFM:NREP 1 HM:PFM:REP 25->231|PF01863|3.7e-66|35.3|204/205|DUF45| OP:NHOMO 516 OP:NHOMOORG 434 OP:PATTERN -----------------------1-11--1---11---1211-11111-1212-1111111------1 -------1---1-------------------1---------111---------------------------1111111-111---1-1-111-1-------------------------------11111411112-----211------11---11-------2------------------111-----1--11111111-121111--11--111------1-------1------------------------------------------------------------------------------------------13111-1-11111111111112-211-11211-1121-1111-1--1--1---111111111212111111111122222222221-11111111112-1111121111111111111111111223233333311121-11------------1-11-11-1-11------11111111111111111111111111121111111121--1111111111111111111111111222221111111-22-111-121211-11---1-1------21111211111112122222222111111-11-1111-1---1-----1--1-1--1----121-1----------1------------------1--------------1--1----1----------------------------1-----1----1-----1111211-----1-------1---1111111122-1--------1-----1--11111211111--------2----111212211111111-1111------------1------1---1--1-----11------2-1-1------1- -1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 37.1 SQ:SECSTR ##########################################################################################################################GGGTcEccccccHHHHHHHHHHHHHHHHHTcccEEEEEccccEEEccTTcccEEEEEHHHHHHcHHHHHHHHHHHHHHHHTTcEEEEc########################### DISOP:02AL 1-5| PSIPRED ccccccccccccEEEEEEEEEccEEEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccEEEEEEEEcccccEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEccccEEEEEHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHccccccc //