[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59361.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->101 2d2aB PDBj 6e-14 18.0 %
:RPS:SCOP  1->101 1nwbA  b.124.1.1 * 9e-13 24.2 %
:RPS:PFM   18->112 PF05610 * DUF779 5e-39 65.3 %
:HMM:PFM   19->112 PF05610 * DUF779 4.3e-49 61.7 94/95  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59361.1 GT:GENE ABA59361.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3297130..3297519) GB:FROM 3297130 GB:TO 3297519 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59361.1 GB:DB_XREF GI:76884680 LENGTH 129 SQ:AASEQ MAQSIQVKRVTVTKEAKKVIDQLREKHGDLMFHQSGGCCDGSSPMCYEDGDFKVGGSDIKLGEVYGCPFYMARDQFEYWKHTQLTLDVKSGRGSSFSIEIPMGVRFIIQSRMFTEEELQALEKQDPLSA GT:EXON 1|1-129:0| RP:PDB:NREP 1 RP:PDB:REP 7->101|2d2aB|6e-14|18.0|89/102| RP:PFM:NREP 1 RP:PFM:REP 18->112|PF05610|5e-39|65.3|95/95|DUF779| HM:PFM:NREP 1 HM:PFM:REP 19->112|PF05610|4.3e-49|61.7|94/95|DUF779| RP:SCP:NREP 1 RP:SCP:REP 1->101|1nwbA|9e-13|24.2|95/101|b.124.1.1| OP:NHOMO 129 OP:NHOMOORG 126 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111121----1-11----31111---11--1-1111-------------------------------1---1-1------------------------------------1-----------------------------------------------1-----------------1-------1111111------11--------------------------------------------------------------------------------------------------------------------------------------------1-----------11-----------1111-111111-11111111-1--1--1111111111------1---------------1---1--------------------------------1--1-------------1------11--------1111------1111111---1----111-------------11----------------------------1---1------------------------1----------------------------------11-----------------------------------------------------------------------------------------------------------------------------------111---------------------------------------------11111------------------------------------------------------------------ -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 69.0 SQ:SECSTR ######ccccEEcHHHHHHHHHHHHHcTTccEEEEEEEcccEEEEEEEc###cccTTEEEE#EETTEEEEEEGGGHHHHTTc##EEEEEETTEEEEEEEcT############################ DISOP:02AL 1-5, 127-129| PSIPRED ccccccccEEEEcHHHHHHHHHHHHHcccEEEEccccccccccccccccccEEEcccEEEEEEEccccEEEcccHHHHEEEEEEEEEEEcccccEEEEEcccccEEEEEEEcccHHHHHHHHHcccccc //