[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59365.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:HMM:PFM   26->78 PF04306 * DUF456 0.00022 20.8 53/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59365.1 GT:GENE ABA59365.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3302276..3302521 GB:FROM 3302276 GB:TO 3302521 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59365.1 GB:DB_XREF GI:76884684 LENGTH 81 SQ:AASEQ MGKVVCFSYTSRRKDMDSLFSSVGNVFGGLLSLIWLIIVVWAIVKVAKSGASTLAKIIWIIALIIFPLIGLIAWLLFGPKG GT:EXON 1|1-81:0| TM:NTM 2 TM:REGION 21->43| TM:REGION 54->76| SEG 30->49|llsliwliivvwaivkvaks| SEG 54->73|lakiiwiialiifpliglia| HM:PFM:NREP 1 HM:PFM:REP 26->78|PF04306|0.00022|20.8|53/140|DUF456| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //