[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59370.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->112 PF07509 * DUF1523 3e-09 44.1 %
:HMM:PFM   10->55 PF07509 * DUF1523 3.8e-07 28.3 46/175  
:HMM:PFM   50->126 PF07509 * DUF1523 6.3e-18 42.1 76/175  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59370.1 GT:GENE ABA59370.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3308454..3308846 GB:FROM 3308454 GB:TO 3308846 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59370.1 GB:DB_XREF GI:76884689 LENGTH 130 SQ:AASEQ MNAFKRIGAIIAITLVLSVFVALISYQWPRTATFRIVDTEVKRIEGGDQYRITAIRQEDDKRMVLRNEDAWYRFKFDSADIQGDAAIAEKNDFMVEMTYYGWRSNLMSWFWNVSDLDILREKAPAPTPQE GT:EXON 1|1-130:0| TM:NTM 1 TM:REGION 7->27| RP:PFM:NREP 1 RP:PFM:REP 11->112|PF07509|3e-09|44.1|102/172|DUF1523| HM:PFM:NREP 2 HM:PFM:REP 10->55|PF07509|3.8e-07|28.3|46/175|DUF1523| HM:PFM:REP 50->126|PF07509|6.3e-18|42.1|76/175|DUF1523| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------111----1------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 120-130| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEcccEEEEEEEEcccccEEEEEEcccEEEEEEccccHHHHHHHHHHcccEEEEEEEcEEEEHHHHcccEEEEEEcccccccccccc //