[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59392.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59392.1 GT:GENE ABA59392.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3333910..3334170) GB:FROM 3333910 GB:TO 3334170 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59392.1 GB:DB_XREF GI:76884711 LENGTH 86 SQ:AASEQ MPRTRHSKQEIELALQHAEAKGWRIEVGGSHAWGKMYCPANDAGCRCGEFCITSIWSTPRNPSNHARQLRRVVDRCINIDMLNSED GT:EXON 1|1-86:0| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-----------------------------------------------------------------------------------------1-------1------------11---------11-----------------------------------------------------------------------------------------------------------------------1------------1------------------------------------------------------------------------------------------------1-------------------------------11--1--------------------------------11----1------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 84-86| PSIPRED cccccccHHHHHHHHHHccccccEEEEcccccccEEEccccccccEEcHHHEEHHccccccccHHHHHHHHHHHHHcccccccccc //