[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59396.1
DDBJ      :             Universal stress protein, UspA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   249->306 3fh0B PDBj 9e-06 38.6 %
:RPS:PDB   7->306 3cisF PDBj 1e-21 16.8 %
:RPS:SCOP  3->139 1mjhA  c.26.2.4 * 8e-13 15.1 %
:RPS:SCOP  146->307 1mjhA  c.26.2.4 * 2e-16 21.2 %
:HMM:SCOP  4->143 1mjhA_ c.26.2.4 * 2.3e-15 30.0 %
:HMM:SCOP  146->315 2gm3A1 c.26.2.4 * 3.1e-25 30.5 %
:RPS:PFM   5->139 PF00582 * Usp 3e-04 26.8 %
:RPS:PFM   251->306 PF00582 * Usp 2e-07 42.9 %
:HMM:PFM   4->139 PF00582 * Usp 3e-14 23.5 136/140  
:HMM:PFM   146->306 PF00582 * Usp 6.4e-20 27.3 139/140  
:BLT:SWISS 4->307 USPE_HAEIN 5e-26 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59396.1 GT:GENE ABA59396.1 GT:PRODUCT Universal stress protein, UspA GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3337901..3338857) GB:FROM 3337901 GB:TO 3338857 GB:DIRECTION - GB:PRODUCT Universal stress protein, UspA GB:PROTEIN_ID ABA59396.1 GB:DB_XREF GI:76884715 InterPro:IPR006015 InterPro:IPR006016 LENGTH 318 SQ:AASEQ MNLFKNILYVSEGAVAQDASIMRAVSLAENNQADLTAIDVVPGIGILRSGSISNELQTATVNERRKKLEALIEPYRKRVRIRLDVLEGRTFLEIIRAILRNDHDLLIKPAENPSFIERLFGSDDMQLLRNCPCPVWLTRTEEKSKYEHILAAVDFNPDMPDAIEQNLNQQILDLSSSLAFSDFAALHVVHVWDAPAEAMLRTWADDPQKASIAYVEGVRSSHENAYNRLRRQLIERVGRDASDYLSPEFHMRRGTAATIIPDIAKQLHADLVVMGTVARTGIAGLLIGNTAEAILEQLQCSVLAVKPPGFVSPVKLSK GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 4->307|USPE_HAEIN|5e-26|31.0|287/309| SEG 172->186|ldlssslafsdfaal| BL:PDB:NREP 1 BL:PDB:REP 249->306|3fh0B|9e-06|38.6|57/122| RP:PDB:NREP 1 RP:PDB:REP 7->306|3cisF|1e-21|16.8|268/277| RP:PFM:NREP 2 RP:PFM:REP 5->139|PF00582|3e-04|26.8|135/139|Usp| RP:PFM:REP 251->306|PF00582|2e-07|42.9|56/139|Usp| HM:PFM:NREP 2 HM:PFM:REP 4->139|PF00582|3e-14|23.5|136/140|Usp| HM:PFM:REP 146->306|PF00582|6.4e-20|27.3|139/140|Usp| GO:PFM:NREP 2 GO:PFM GO:0006950|"GO:response to stress"|PF00582|IPR006016| GO:PFM GO:0006950|"GO:response to stress"|PF00582|IPR006016| RP:SCP:NREP 2 RP:SCP:REP 3->139|1mjhA|8e-13|15.1|136/143|c.26.2.4| RP:SCP:REP 146->307|1mjhA|2e-16|21.2|137/143|c.26.2.4| HM:SCP:REP 4->143|1mjhA_|2.3e-15|30.0|140/0|c.26.2.4|1/2|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 146->315|2gm3A1|3.1e-25|30.5|164/0|c.26.2.4|2/2|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 203 OP:NHOMOORG 168 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-------------------------1------------------1-------------------------------------------------------------1-----------------------------------------------------------------1-------------1-----------1-11-1---1---------------------------11222-212111211121411222132231---31--------11111111111111111-111111111111111111111111111111111111111111111-111111-1111111-1111---------21-1-12-----111-1111-111----------2-1111-221221211-------------11122222211111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 95.6 SQ:SECSTR #ccTTEEEEEccccHHHHHHHHHHHHHHHHHTccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHccccccEEEEEEcccHHHHHHHHGHGGGccEEEEEcccTTccTccccHHHHHHHHHccccEEEEcTTcccccccEEEEccccHHHHHHHHHHHHH########HHHHHTccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHTHHHHHHcTTHcTTccETcccEEEEEEcccHHHHHHHHGGGHGccEEEEEcccccccTTccccHHHHHHHHHccccEEEEcccccccG##### DISOP:02AL 316-318| PSIPRED cccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHccccEEEEccccccHHHHHcccHHHHHHHHccccEEEEEccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHccccEEEEccccccHHHHHEEcHHHHHHHHHccccEEEEccccccccccccc //