[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59406.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:348 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->165 3eieA PDBj 6e-04 31.2 %
:RPS:PDB   24->261 2bjwA PDBj 9e-07 20.0 %
:RPS:SCOP  8->39 1w36B1  c.37.1.19 * 5e-04 12.5 %
:RPS:SCOP  24->270 1ny5B2  c.37.1.20 * 7e-09 15.8 %
:HMM:SCOP  8->161 1jbkA_ c.37.1.20 * 6.7e-15 31.0 %
:RPS:PFM   24->119 PF07728 * AAA_5 7e-05 34.0 %
:HMM:PFM   25->136 PF00004 * AAA 7e-09 27.0 100/130  
:BLT:SWISS 24->184 MDN1_GIALA 1e-06 26.6 %
:BLT:SWISS 231->328 MURG_METPP 5e-05 32.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59406.1 GT:GENE ABA59406.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3351423..3352469) GB:FROM 3351423 GB:TO 3352469 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59406.1 GB:DB_XREF GI:76884725 LENGTH 348 SQ:AASEQ MRPSQITTLLKREFTAVRNGQHTPVMLWGPPGVGKSQILFQVADSFGVPLIDLRLSQLEPTDLRGIPFRIDHWVEWAIPSMLPNSKRHGSEGILFLDELTSAPPTVSAAAYQLILDRQLGEYTVPEGWAIVAAGNRQGDRGITYTLPAPLANRFTHYEIEPHIGDWVTWAAHRSIDQRLIGFLLYRPELLFDFDPNQNPLAFPTPRSWEYAHRALQKFEDIPELLLETLQACVGPGAGLELKAFIDNMAQMPDVEAILRGKDVSIPEALDLQYGVAATLVRRAVDARNSHEAHQIYGHILGYATRLPEREIGVMLVTEMFRAIGRPLLKHPEFAKWARQVSDLMLYER GT:EXON 1|1-348:0| BL:SWS:NREP 2 BL:SWS:REP 24->184|MDN1_GIALA|1e-06|26.6|158/4835| BL:SWS:REP 231->328|MURG_METPP|5e-05|32.3|96/367| BL:PDB:NREP 1 BL:PDB:REP 9->165|3eieA|6e-04|31.2|141/303| RP:PDB:NREP 1 RP:PDB:REP 24->261|2bjwA|9e-07|20.0|205/242| RP:PFM:NREP 1 RP:PFM:REP 24->119|PF07728|7e-05|34.0|94/135|AAA_5| HM:PFM:NREP 1 HM:PFM:REP 25->136|PF00004|7e-09|27.0|100/130|AAA| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF07728|IPR011704| GO:PFM GO:0016887|"GO:ATPase activity"|PF07728|IPR011704| RP:SCP:NREP 2 RP:SCP:REP 8->39|1w36B1|5e-04|12.5|32/469|c.37.1.19| RP:SCP:REP 24->270|1ny5B2|7e-09|15.8|221/248|c.37.1.20| HM:SCP:REP 8->161|1jbkA_|6.7e-15|31.0|142/195|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 99 OP:NHOMOORG 93 OP:PATTERN 11----------------1-1----------------------------------------------- ----2----------------1----------11-1-1-1----1----------------1--1---2-----------11----------------------------------------------------------------------------------1------------------111---------------------------------------------11---------------------------1-----11---------------------------------------------------------1-1-------1-1-----1111------1-122-----------------1---------1-------11111------------------1----------------------11-1111-----------------------------------------------------------1----------11---------1-------11---------------1-------------------1-1---1111--1-11-111-2------1----------------------1---1-----1---------------------1-------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------2111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 328 STR:RPRED 94.3 SQ:SECSTR ccHcHHHHHHcGGccEEEEEccccEEEEccTTccHHHHHHHHHHTcTTTTccEEEEGGGccHHHHHHHHHccccccccHcccccHHHHTTTcEEEEEcGGGccHHHHHHHHHHHHHcEETcccEEcccEEEEEEccHHHHHHHTcccHHHHHHHTcEEEEcccGGcEEEEcccGGGcHHHHHHHHHHHHTTHHcGGHHHHHHTTTTHHHHHHTTccccccccHHHHHHHHHcccTTHHHHHHHHHHHHHHHHcccccccccHHHccccTccHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHH#TTc################### PSIPRED ccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHccccEEEEEcccccHHHEEEEEEEcccccHHcccHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccccEEccccEEEEEEccccccccccccccHHHHccEEEEEEcccHHHHHHHHHHccccHHHHHHHHHccHHHHHcccccHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHccc //