[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59411.1
DDBJ      :             Electron transport protein SCO1/SenC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->190 1xzoA PDBj 9e-10 26.1 %
:RPS:PDB   42->184 2b7jA PDBj 6e-11 17.7 %
:RPS:SCOP  50->184 1wp0A1  c.47.1.10 * 1e-11 18.5 %
:HMM:SCOP  40->203 2b7kA1 c.47.1.10 * 2.1e-28 28.3 %
:RPS:PFM   50->181 PF02630 * SCO1-SenC 8e-10 26.7 %
:HMM:PFM   46->183 PF02630 * SCO1-SenC 5.3e-16 22.8 136/174  
:BLT:SWISS 51->190 SCO1_BACSU 3e-09 26.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59411.1 GT:GENE ABA59411.1 GT:PRODUCT Electron transport protein SCO1/SenC GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3355004..3355630) GB:FROM 3355004 GB:TO 3355630 GB:DIRECTION - GB:PRODUCT Electron transport protein SCO1/SenC GB:PROTEIN_ID ABA59411.1 GB:DB_XREF GI:76884730 InterPro:IPR003782 LENGTH 208 SQ:AASEQ MRTLFLSTLLAIAGLTALWVGTDGGRAFTAETARRLEVREHPKPVPNWHLEDQNAKTLALGDWHGRYVVVDFIYTSCTSACLTLSSGMGNLQREFEKALDKDRLRLLSISFDPEKDTPEQLRHHLSHFSGEGKYWAAARPTHTVEKKAILDFFKVTVIPDGMGGYTHTAGYHVINPQGRLVAIFGVEEYPKLQDYLTMALVEGDVGEG GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 51->190|SCO1_BACSU|3e-09|26.1|138/193| TM:NTM 1 TM:REGION 1->23| SEG 75->86|tsctsacltlss| BL:PDB:NREP 1 BL:PDB:REP 51->190|1xzoA|9e-10|26.1|138/172| RP:PDB:NREP 1 RP:PDB:REP 42->184|2b7jA|6e-11|17.7|130/158| RP:PFM:NREP 1 RP:PFM:REP 50->181|PF02630|8e-10|26.7|131/164|SCO1-SenC| HM:PFM:NREP 1 HM:PFM:REP 46->183|PF02630|5.3e-16|22.8|136/174|SCO1-SenC| RP:SCP:NREP 1 RP:SCP:REP 50->184|1wp0A1|1e-11|18.5|135/160|c.47.1.10| HM:SCP:REP 40->203|2b7kA1|2.1e-28|28.3|159/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 18 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------1--------------------------------------------------------------------------------------1-1-------11------------------1212----------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 86.1 SQ:SECSTR ##########################ccEEEEEcccTc###cccccccEEEETTccEEEGGGGTTccEEEEEEcTTccTHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccTTTccHHHHHHHGGGccTTcEEEEcHHHHHHHHHHEccHHHHHHHHHHTTcccTTcccEEEEcTTccEEEEEcTTccHHHHHHHHHHcHHHHcccc DISOP:02AL 33-41, 205-208| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHcccccccccEEEEcccccEEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccEEEccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHccccc //