[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59413.1
DDBJ      :             Cytochrome c oxidase, subunit II
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->173 2qpeB PDBj 6e-12 31.4 %
:RPS:PDB   75->176 3dtuB PDBj 2e-12 22.4 %
:RPS:SCOP  69->173 1ehkB1  b.6.1.2 * 9e-12 31.7 %
:HMM:SCOP  77->173 1ar1B1 b.6.1.2 * 1.4e-23 35.5 %
:RPS:PFM   83->166 PF00116 * COX2 6e-07 40.0 %
:HMM:PFM   98->172 PF00116 * COX2 3.3e-15 36.6 71/120  
:HMM:PFM   5->24 PF05545 * FixQ 0.0009 30.0 20/49  
:BLT:SWISS 65->173 COX2_THETH 2e-11 31.4 %
:PROS 114->166|PS00078|COX2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59413.1 GT:GENE ABA59413.1 GT:PRODUCT Cytochrome c oxidase, subunit II GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3357379..3357909) GB:FROM 3357379 GB:TO 3357909 GB:DIRECTION - GB:PRODUCT Cytochrome c oxidase, subunit II GB:PROTEIN_ID ABA59413.1 GB:DB_XREF GI:76884732 InterPro:IPR001505 InterPro:IPR002429 LENGTH 176 SQ:AASEQ MQSIASYITLLGTVLLIGVFYFVISNSKLQEEYSSFSKKWYSFRGKWFIFLIILGTALTLGTLIPFPIPSQAKVYSSDDYQQVDVSGHQWYWTMSTDTVVAGKPVEFRVIGADVNHGFGVYNEDLELVAQVQAMPDYTNKLIHTFDEPGKYRIFCLEYCGLAHHVMMSELKVEAAN GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 65->173|COX2_THETH|2e-11|31.4|105/135| PROS 114->166|PS00078|COX2|PDOC00075| TM:NTM 2 TM:REGION 5->27| TM:REGION 47->69| SEG 48->64|fifliilgtaltlgtli| BL:PDB:NREP 1 BL:PDB:REP 65->173|2qpeB|6e-12|31.4|105/166| RP:PDB:NREP 1 RP:PDB:REP 75->176|3dtuB|2e-12|22.4|98/259| RP:PFM:NREP 1 RP:PFM:REP 83->166|PF00116|6e-07|40.0|80/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 98->172|PF00116|3.3e-15|36.6|71/120|COX2| HM:PFM:REP 5->24|PF05545|0.0009|30.0|20/49|FixQ| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 1 RP:SCP:REP 69->173|1ehkB1|9e-12|31.7|101/128|b.6.1.2| HM:SCP:REP 77->173|1ar1B1|1.4e-23|35.5|93/145|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 42 OP:NHOMOORG 40 OP:PATTERN ------1--------1-1------1------1-----------------------------------1 --------------------------------------------------------------1-------------------------------------------------------------------------11111----1--------------------------------------1-11----1-----------------1-------122--11------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---------------------------------------------------1-------------------------------------------------------------------11---------1-------------------------------------1111--------------------------1111----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 63.6 SQ:SECSTR ################################################################TTGHccccccHHHHHHHHHTTccGGGTTTcccccEEETcEEEEEEEEccccEEEEEGGGTEHGTEEEEEccTccEEEEEEccccEEEEEcccccccTTGGGccEEEEEEcHH DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccEEEEHHHHHHHHHHHHHHHccccccccHHHHcccccEEEEEEEEEEEEEccEEEEEcccEEEEEEEEcccEEEEEcccccHHHEEEEEEEccEEEEEEEEEcccEEEEEEEEccccccccccEEEEEEEEcc //