[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59414.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   117->185 PF04205 * FMN_bind 3e-08 23.1 65/79  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59414.1 GT:GENE ABA59414.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3358290..3358877) GB:FROM 3358290 GB:TO 3358877 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59414.1 GB:DB_XREF GI:76884733 LENGTH 195 SQ:AASEQ MGPAMPILEFMKALKNGRHFFLIAGAMIAVLVAGNAIGTIYYGKKEALELAFGKGAQVEILSLFLTDSQVEEIEQLARAKLESKLFTFYVGRNEGELLGYAAIESHTVRTKPETLLIILTSRGELDKIYTLAFHEPPEYQPPQRWFAQLYHRQITELNLNYGIQGITGATLSSRAAVSSARKVLAIYQVVIKEKY GT:EXON 1|1-195:0| TM:NTM 1 TM:REGION 19->41| SEG 171->185|lssraavssarkvla| HM:PFM:NREP 1 HM:PFM:REP 117->185|PF04205|3e-08|23.1|65/79|FMN_bind| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1-111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------1--11-----------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHEEEEEcHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHccccccccEEEEEEEEccEEEEEEEEEEEEEEccEEEEEEEEccccccccEEEEEEcccHHHccccHHHHHHcccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc //