[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59416.1
DDBJ      :             conserved hypothetical protein, DoxX
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->94 PF07681 * DoxX 5.1e-20 42.0 81/85  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59416.1 GT:GENE ABA59416.1 GT:PRODUCT conserved hypothetical protein, DoxX GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3361216..3361620 GB:FROM 3361216 GB:TO 3361620 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein, DoxX GB:PROTEIN_ID ABA59416.1 GB:DB_XREF GI:76884735 InterPro:IPR011637 LENGTH 134 SQ:AASEQ MSMNWGMAADGLGKLILRLTLGILVLFHGINKITYGISGIEGMLQGIGLPASIAYGVYIGEILGPILLLLGWYARLGAGLIAINMLFALFLAHRPELLNLTPQGGWALELQGMFLFTALALILTGPGRFSLNNR GT:EXON 1|1-134:0| TM:NTM 4 TM:REGION 13->35| TM:REGION 38->60| TM:REGION 68->90| TM:REGION 107->128| SEG 11->26|glgklilrltlgilvl| SEG 59->71|igeilgpillllg| HM:PFM:NREP 1 HM:PFM:REP 14->94|PF07681|5.1e-20|42.0|81/85|DoxX| OP:NHOMO 46 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1-111-11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------1111----------1--12-11-1------------1-1-------1----------------------------11-1-------1-------11---------1----------------------------1--1--------21-1----------------------------------11--1--------------------------1-------------------------1-1-----------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 133-134| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccc //