[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59419.1
DDBJ      :             Anti-sigma regulatory factor (Ser/Thr protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->138 1th8A PDBj 2e-07 32.9 %
:RPS:PDB   42->99 3ehjA PDBj 9e-05 29.6 %
:RPS:SCOP  46->97 1gjvA2  d.122.1.4 * 1e-05 28.8 %
:HMM:SCOP  22->140 1l0oA_ d.122.1.3 * 8.8e-09 21.8 %
:HMM:PFM   46->123 PF02518 * HATPase_c 3.5e-10 21.3 75/111  
:BLT:SWISS 1->133 RSBW_BACSU 3e-11 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59419.1 GT:GENE ABA59419.1 GT:PRODUCT Anti-sigma regulatory factor (Ser/Thr protein kinase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3363760..3364185 GB:FROM 3363760 GB:TO 3364185 GB:DIRECTION + GB:PRODUCT Anti-sigma regulatory factor (Ser/Thr protein kinase GB:PROTEIN_ID ABA59419.1 GB:DB_XREF GI:76884738 InterPro:IPR003594 LENGTH 141 SQ:AASEQ MCNGDIQLEIRIPNKTCYLGFIGEIGEKVANELARYTGDRTALAYHLNLALTEALVNAIEHGNTDDPDQTVRVSIQVLPDQLCIEVYDHGQGFDLDQVGAPDLEYPRERGRGIFLIKSIMDSVNYQKINGGNVLEMRKKLD GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 1->133|RSBW_BACSU|3e-11|31.8|129/160| BL:PDB:NREP 1 BL:PDB:REP 47->138|1th8A|2e-07|32.9|85/132| RP:PDB:NREP 1 RP:PDB:REP 42->99|3ehjA|9e-05|29.6|54/196| HM:PFM:NREP 1 HM:PFM:REP 46->123|PF02518|3.5e-10|21.3|75/111|HATPase_c| RP:SCP:NREP 1 RP:SCP:REP 46->97|1gjvA2|1e-05|28.8|52/165|d.122.1.4| HM:SCP:REP 22->140|1l0oA_|8.8e-09|21.8|119/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 57 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- 121------------------1------------------------------------------------------------1----------------------------------------------1---1--32211---1---------------------12111111----1--1-----------1----------------1---1--------11---------------------------------------------------------------------------------------------------11-------------1--------1-----1-----11-----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21------------111111111------1-------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 72.3 SQ:SECSTR ######################################cccHHHHHHHHHHHHHHHHHHHHTccccccEEEEEEEEEcccEEEEEEEEcccccccTTcccccHHHHTccccHHHHHHHHccEEEEEETTTEEEEEEEEEc# DISOP:02AL 1-5, 102-104| PSIPRED cccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccEEEEEEEEccccccHHHccccccccccccccHHHHHHHHHcEEEEEEccccEEEEEEEEcc //