[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59446.1
DDBJ      :             Pilus retraction protein PilT
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  654/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->334 2ewvA PDBj 3e-90 50.6 %
:RPS:PDB   57->166 3cgiD PDBj 2e-08 16.5 %
:RPS:PDB   154->310 1dmaB PDBj 2e-32 9.1 %
:RPS:SCOP  3->334 1p9rA  c.37.1.11 * 6e-62 35.5 %
:HMM:SCOP  3->338 1p9rA_ c.37.1.11 * 1.4e-78 34.6 %
:RPS:PFM   6->269 PF00437 * GSPII_E 2e-49 47.8 %
:HMM:PFM   12->265 PF00437 * GSPII_E 1.6e-46 30.6 248/282  
:BLT:SWISS 1->344 PILT_PSEAE e-159 80.2 %
:PROS 193->207|PS00662|T2SP_E

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59446.1 GT:GENE ABA59446.1 GT:PRODUCT Pilus retraction protein PilT GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3395949..3396986 GB:FROM 3395949 GB:TO 3396986 GB:DIRECTION + GB:PRODUCT Pilus retraction protein PilT GB:PROTEIN_ID ABA59446.1 GB:DB_XREF GI:76884765 InterPro:IPR001482 InterPro:IPR001687 InterPro:IPR003593 InterPro:IPR006321 LENGTH 345 SQ:AASEQ MDIAELLAFSVKNSASDLHISAGLPPMIRVDGDVRRINLPPMEHKDVHAMIYDIMNDKQRKDYEEFLETDFSFEIPGLARFRVNAFNQNRGAAAVFRTIPSQVLTLEELDAPAVFKNIADNPRGVVLVTGPTGSGKSTTLAAMVNYKNENDFAHILTIEDPIEFVHESKKSLINQREVHRDTHGFSEALRSALREDPDIILVGELRDLETIRLALTAAETGHLVFGTLHTSSAAKTIDRIIDVFPAAEKDMVRSMLSESLRAVISQTLLKKFGGGRVAAHEIMIGNPAIRNLIREDKIPQMYSAIQTGQEAGMQTLDQCLSGLLRRNIVTKQEAAKKAVSKELFQ GT:EXON 1|1-345:0| BL:SWS:NREP 1 BL:SWS:REP 1->344|PILT_PSEAE|e-159|80.2|344/344| PROS 193->207|PS00662|T2SP_E|PDOC00567| BL:PDB:NREP 1 BL:PDB:REP 15->334|2ewvA|3e-90|50.6|314/343| RP:PDB:NREP 2 RP:PDB:REP 57->166|3cgiD|2e-08|16.5|109/117| RP:PDB:REP 154->310|1dmaB|2e-32|9.1|154/189| RP:PFM:NREP 1 RP:PFM:REP 6->269|PF00437|2e-49|47.8|255/273|GSPII_E| HM:PFM:NREP 1 HM:PFM:REP 12->265|PF00437|1.6e-46|30.6|248/282|GSPII_E| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00437|IPR001482| GO:PFM GO:0005622|"GO:intracellular"|PF00437|IPR001482| GO:PFM GO:0006810|"GO:transport"|PF00437|IPR001482| RP:SCP:NREP 1 RP:SCP:REP 3->334|1p9rA|6e-62|35.5|307/378|c.37.1.11| HM:SCP:REP 3->338|1p9rA_|1.4e-78|34.6|321/401|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2093 OP:NHOMOORG 690 OP:PATTERN ------2111111111--1111112112-121-11-11-----1--2-----11-------------- 153----1--------------------------------5---3---3----4--------4-----------------3-346634-------------11---1-21111111111111111-----------1--11444--6333333334431233333333333-3--2-23--2-444434422311111111111111-11111111113331133111111-31111111111111111111111-1111111111111-11111-1-1111111111111111111111111111111111131111111112222222222223232333333312611-3435336342332222223216571111-----211221---1--1------------111-61---1--1-----11-----1122----------1111111111121--211--1------------------------2-111-22--2422245244423322444424282445511657A99667ACA79659799C524444444542A993977467--54333-AABD987996666975513333111111-1-------2454454665598546555568556555555555565--34558------32341253333344434-333535533334343344333333342222222224233232232131111--533333343833--A622222555545831111111111111111555652545256799765677444557672231122123477666656555557777A776664444--2-111111------------------------------------2212222222184 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----3------1-----------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 97.7 SQ:SECSTR ######HHHHHHHTccEEEEccccccEEEETTEEEEcTcccccccTTHHHHHTTcccccccccccccccccccccccHHHTTcccccccHHHHHHTTTccGGGEEcTHHHHHHTTccccEEEEEEEHHHccHHHHHHHHHHHHHHHHHHTTccccccTTcccTccHHccHHHHHHHHHHTTTEHEEEEEEEEEHHHHHHHHHHccccccccTTTccEEEcccHHHHTTccccccEEEEEEEEETTcGGGEEEccccTTcHHHHHHHHHHHTcccccccEEEEcccccccEEEEcHHHHTTcEEEEcccccHHHHHHHHHHHHHHHHHTTTccccTTccETTTc## DISOP:02AL 339-345| PSIPRED ccHHHHHHHHHHccccEEEEccccEEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEEEEccccccEEEEEEcccccccHHHccHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEccHHHcccccEEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHEEEEEEEEEEccccccEEEEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHcccHHHcc //