[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59455.1
DDBJ      :             Peptidoglycan-binding LysM
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  149/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->80 2djpA PDBj 2e-09 13.0 %
:RPS:SCOP  32->80 1e0gA  d.7.1.1 * 6e-08 30.2 %
:HMM:SCOP  31->83 1y7mA2 d.7.1.1 * 2.9e-06 25.0 %
:HMM:PFM   34->80 PF01476 * LysM 7.5e-13 27.9 43/44  
:HMM:PFM   130->168 PF03178 * CPSF_A 0.00029 23.1 39/321  
:BLT:SWISS 34->75 YQBP_BACSU 1e-06 52.4 %
:BLT:SWISS 54->143 ODP1_RALEH 1e-05 28.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59455.1 GT:GENE ABA59455.1 GT:PRODUCT Peptidoglycan-binding LysM GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3406273..3407310) GB:FROM 3406273 GB:TO 3407310 GB:DIRECTION - GB:PRODUCT Peptidoglycan-binding LysM GB:PROTEIN_ID ABA59455.1 GB:DB_XREF GI:76884774 InterPro:IPR002482 LENGTH 345 SQ:AASEQ MNLKKLISIMFLYAMTSSVWGEPVTLNPDAPQRYEVVRDDTLWDIAGRFLRDPWRWPDIWQVNQQINNPHLIYPGDIIFLSYRENGDPVLELQRGLPSYKMSPAVRTSKLEKAIPTIPIDAIQQFLLHPRVVSKETLDNAPYVVAGTEERLILGAGDEIYVRGLSKSAIIRYGIYRGGEVYRDPDHPSKILGYEALFIADANIQRFGDPAILSIQNSTREILVGDRLLPTSDLEFEQHFLPHASPTPVEGKIIAVIDGVSQIGQYQAVALNLGVEDGMEKGTVLAVYQAGRVVRDPISRLPEDKVRLPDERAGVIMVFRAFNHISYGLMMGAERAIHVYDVVRNP GT:EXON 1|1-345:0| BL:SWS:NREP 2 BL:SWS:REP 34->75|YQBP_BACSU|1e-06|52.4|42/219| BL:SWS:REP 54->143|ODP1_RALEH|1e-05|28.4|88/895| RP:PDB:NREP 1 RP:PDB:REP 23->80|2djpA|2e-09|13.0|54/77| HM:PFM:NREP 2 HM:PFM:REP 34->80|PF01476|7.5e-13|27.9|43/44|LysM| HM:PFM:REP 130->168|PF03178|0.00029|23.1|39/321|CPSF_A| RP:SCP:NREP 1 RP:SCP:REP 32->80|1e0gA|6e-08|30.2|43/48|d.7.1.1| HM:SCP:REP 31->83|1y7mA2|2.9e-06|25.0|48/0|d.7.1.1|1/1|LysM domain| OP:NHOMO 151 OP:NHOMOORG 151 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1111111111111111111111-111111111-111--1------------111111111111111---------------------------111111111-1111111111111111111111--111-1--------------------------------------------------------------------------------------------1-----11111111----------------111111111-111111-1111----1111----------1111111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 16.8 SQ:SECSTR ######################ccccccEEEEEEcccTTccHHHHHHHHTHHTccHHHHHHHHGTccccccGGGcccEEE######################################################################################################################################################################################################################################################################### DISOP:02AL 1-2, 91-111| PSIPRED ccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHcccccHHHHHHHHccccccccEEccccEEEEEEEcccccEEEcccccccEEccccEEccccccccccccHHHHcccccccEEccHHHHccccEEEEcccccEEEccccEEEEEEcccccccEEEEEEccEEEEccccccEEEEEEEEEEEEEEEEEccccEEEEEEEEccccccccEEEEccccccccEEEEccccccccEEEEEEccccEEEccccEEEEEcccccccccccEEEEEEcccEEEEccccccccccccccHHEEEEEEEEcccccEEEEEEEccccEEEcEEEEcc //