[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59459.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->68 PF09103 * BRCA-2_OB1 0.00051 25.8 31/118  
:BLT:SWISS 112->187 NUOC_RHORT 1e-04 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59459.1 GT:GENE ABA59459.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3410668..3411261 GB:FROM 3410668 GB:TO 3411261 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA59459.1 GB:DB_XREF GI:76884778 LENGTH 197 SQ:AASEQ MPAWRSAETNFPWRHLGLAFLGLLLGTQCTASESFNIRSASTQLVKGVYRLHAQIDYPLNKEVKTAIESGIPLIVNQEIEVLRLRWWLWPKTIKHIILRYQLKYHALSEQFVLTYLNQDTQRTYPNLTAAIKQLSTIKHYPLITRGELDLHHNYRIRLKTSLSIKDLPAPMRPLAYLSPQWYLDSPWFSWLLESPNI GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 112->187|NUOC_RHORT|1e-04|32.4|74/100| SEG 16->26|lglaflglllg| HM:PFM:NREP 1 HM:PFM:REP 38->68|PF09103|0.00051|25.8|31/118|BRCA-2_OB1| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111------11-----1111--------------------111--11-----------1111-------------------------------------------------------------------------------------------111-1------------------------------------------------------------------------------------------------------1---------------------------------------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEcccEEEEEEEEEcccHHHHHHHHccEEEEEEEEEEEEEcccccccHHHHccEEEEEEEEEccccEEEEEEccccEEcccccHHHHHHHHHHHcccEEcccccccccccEEEEEEEEEcHHHccccEEEcccccccccccccEEEEEEEcccc //