[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59468.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->65 PF02185 * HR1 9.6e-06 26.3 57/70  
:BLT:SWISS 10->88 CLF1_KLULA 3e-04 33.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59468.1 GT:GENE ABA59468.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3422192..3422563 GB:FROM 3422192 GB:TO 3422563 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59468.1 GB:DB_XREF GI:76884787 LENGTH 123 SQ:AASEQ MLKALLFVINHSLQAKSKIKTAYDNAKRALPGGLAKTKEQASKEAEELQVKVDRLKTELETYKRKEELWLRRWQQIAFHMRQKGIQMASIDRTPPEGAELPSNTETAQILRSFDKEIPPSGRI GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 10->88|CLF1_KLULA|3e-04|33.8|74/684| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 32->71| HM:PFM:NREP 1 HM:PFM:REP 9->65|PF02185|9.6e-06|26.3|57/70|HR1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 33-49, 94-95, 121-123| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccccccHHHHHHHHHHHcccccccc //