[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59472.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->61 1f2t.1  c.37.1.12 * 3e-05 20.3 %
:HMM:SCOP  1->45 1w1wA_ c.37.1.12 * 4e-09 46.5 %
:HMM:PFM   3->45 PF02463 * SMC_N 1.4e-08 34.9 43/220  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59472.1 GT:GENE ABA59472.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3428515..3428727 GB:FROM 3428515 GB:TO 3428727 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA59472.1 GB:DB_XREF GI:76884791 LENGTH 70 SQ:AASEQ MRLKSLYIGQYKNLLDFSLSFDGSSFIDVFVGKNGTGKSNLFEALIEIFRHIVEYDRSKADLGFSLPCGL GT:EXON 1|1-70:0| SEG 14->28|lldfslsfdgssfid| HM:PFM:NREP 1 HM:PFM:REP 3->45|PF02463|1.4e-08|34.9|43/220|SMC_N| RP:SCP:NREP 1 RP:SCP:REP 1->61|1f2t.1|3e-05|20.3|59/288|c.37.1.12| HM:SCP:REP 1->45|1w1wA_|4e-09|46.5|43/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEccccccccccEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccccccccc //