[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59476.1
DDBJ      :             GTP-binding protein, GTP1/OBG family
Swiss-Prot:OBG_NITOC    RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg;

Homologs  Archaea  14/68 : Bacteria  910/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
a.118.1b.117.1c.37.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->345 1lnzA PDBj 5e-51 40.9 %
:RPS:PDB   45->343 2bnxA PDBj 7e-25 10.5 %
:RPS:SCOP  3->147 1lnzA1  b.117.1.1 * 2e-49 37.2 %
:RPS:SCOP  168->344 1z2cB1  a.118.1.23 * 2e-21 14.7 %
:HMM:SCOP  2->158 1lnzA1 b.117.1.1 * 7.6e-58 59.2 %
:HMM:SCOP  150->341 1ni3A1 c.37.1.8 * 3.4e-48 42.9 %
:RPS:PFM   3->147 PF01018 * GTP1_OBG 1e-48 59.3 %
:RPS:PFM   171->246 PF01926 * MMR_HSR1 5e-13 44.7 %
:HMM:PFM   3->158 PF01018 * GTP1_OBG 1.5e-64 53.2 156/156  
:HMM:PFM   171->285 PF01926 * MMR_HSR1 1.5e-23 40.8 103/108  
:HMM:PFM   302->336 PF03308 * ArgK 2.5e-05 34.3 35/267  
:HMM:PFM   267->311 PF02492 * cobW 5.3e-05 17.8 45/173  
:BLT:SWISS 1->345 OBG_NITOC e-179 100.0 %
:PROS 213->226|PS00905|GTP1_OBG
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59476.1 GT:GENE ABA59476.1 GT:PRODUCT GTP-binding protein, GTP1/OBG family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3431064..3432101 GB:FROM 3431064 GB:TO 3432101 GB:DIRECTION + GB:PRODUCT GTP-binding protein, GTP1/OBG family GB:PROTEIN_ID ABA59476.1 GB:DB_XREF GI:76884795 InterPro:IPR002917 InterPro:IPR006073 InterPro:IPR006074 InterPro:IPR006169 LENGTH 345 SQ:AASEQ MKFIDEAIIKVQAGAGGHGCLSFRREKFIPFGGPDGGDGGNGGSIYLIADKNINTLVDFRHQHHFRARRGENGRGRLQTGKSSEDIYIPVPLGTEAWEAETGELLGDLTRPGQTLLVAKGGAHGLGNARFKSSTNRAPRKTTQGKPGEERTLRLELKLLADVGLLGLPNAGKSTFIRQVSAATPKVADYPFTTLHPHLGVVRIDSNRSFVAADIPGLIEGAAQGAGLGVRFLKHLSRTRLLLHFVDVAPLEPTLSPVDSVRAIHRELQQFSPELAAQEQWLVFNKTDLISSSERASRCQEIIREICWQKPVYEISALTGEGCQRLIHAVMQYLEEVSPYEKEDSQ GT:EXON 1|1-345:0| SW:ID OBG_NITOC SW:DE RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg; SW:GN Name=obg; OrderedLocusNames=Noc_3035; SW:KW Complete proteome; Cytoplasm; GTP-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->345|OBG_NITOC|e-179|100.0|345/345| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 213->226|PS00905|GTP1_OBG|PDOC00704| SEG 32->43|ggpdggdggngg| SEG 148->167|eertlrlelklladvgllgl| BL:PDB:NREP 1 BL:PDB:REP 3->345|1lnzA|5e-51|40.9|330/332| RP:PDB:NREP 1 RP:PDB:REP 45->343|2bnxA|7e-25|10.5|287/337| RP:PFM:NREP 2 RP:PFM:REP 3->147|PF01018|1e-48|59.3|145/156|GTP1_OBG| RP:PFM:REP 171->246|PF01926|5e-13|44.7|76/105|MMR_HSR1| HM:PFM:NREP 4 HM:PFM:REP 3->158|PF01018|1.5e-64|53.2|156/156|GTP1_OBG| HM:PFM:REP 171->285|PF01926|1.5e-23|40.8|103/108|MMR_HSR1| HM:PFM:REP 302->336|PF03308|2.5e-05|34.3|35/267|ArgK| HM:PFM:REP 267->311|PF02492|5.3e-05|17.8|45/173|cobW| GO:PFM:NREP 3 GO:PFM GO:0005525|"GO:GTP binding"|PF01018|IPR006169| GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| RP:SCP:NREP 2 RP:SCP:REP 3->147|1lnzA1|2e-49|37.2|145/157|b.117.1.1| RP:SCP:REP 168->344|1z2cB1|2e-21|14.7|163/346|a.118.1.23| HM:SCP:REP 2->158|1lnzA1|7.6e-58|59.2|157/157|b.117.1.1|1/1|Obg GTP-binding protein N-terminal domain| HM:SCP:REP 150->341|1ni3A1|3.4e-48|42.9|189/296|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1905 OP:NHOMOORG 1105 OP:PATTERN ----11----------11222222-------1-----------1---------1------------1- 1111111111111112211-11222111111211111111122221112111111211221121221111211111111111211222222212222112222221221222222222222222222222222222111111111111111111111111111211211111111222111122221111222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222122121113212222111212122211221111111111111111111111111-11111111111211111111111111111111222211111111111111111112212222211121222212122111112221111122222222222222222222222222221111111222221111222122211222112222222122222212122111111111222222222111112111222211111211111111122112112222112222111111111111111121111-2211122111111222222212222222-22222222222222222221212211211111111111111112222222211222222222222221222222222212111222222222222222222222222211111111111111111112222222222122222222222122222222222111122212222221222122222221222-12221221112222112221111112221211 2---323-311-1111111111111111111111111111111111211-111-111--1111111111-1111111-1111111111-1211111--11-11322-4624434323113243395162CS4-55612323134-2222141252333411332212222123442244b4342243451442253332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 99.4 SQ:SECSTR ##EEEHHHHHHHcHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHTccTTTccTTHHHHHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHTccTTcHHHHHHHHHHHHHHHTccccTTHHHHHHHHHHHHHHHHTccTTHHHHHHTcTTccHHHHHHHHHHHHHHHTTcccHHHccHHHHHHHHHHHHHTTHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHTTcTHHHHHHHHHHHHTTccccTTTHHHHHHHHHHH DISOP:02AL 68-77, 136-156, 336-345| PSIPRED ccEEEEEEEEEEEcccccccEEcccccccccccccccccccccEEEEEEEccccHHHHHccccEEEccccccccccccccccccEEEEEEEccEEEEEcccccEEEEEccccEEEEEEccccccccHHHHHHHHHHcHHHHccccccccEEEEEccccccEEEEEccccccHHHHHHHHHccccccccccccccccEEEEEEEccccEEEEEEcccccccccHHHHHHHHHHHHHHHccEEEEEEEcccccccccHHHHHHHHHHHHHHHcHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHccccccccccc //