[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59481.1
DDBJ      :             Cytochrome oxidase assembly
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:342 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->304 PF02628 * COX15-CtaA 3e-08 26.9 %
:HMM:PFM   7->323 PF02628 * COX15-CtaA 6.8e-91 41.4 292/301  
:BLT:SWISS 214->304 CTAA_OCHA4 3e-04 42.3 %
:PROS 165->178|PS00165|DEHYDRATASE_SER_THR
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59481.1 GT:GENE ABA59481.1 GT:PRODUCT Cytochrome oxidase assembly GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3436182..3437210) GB:FROM 3436182 GB:TO 3437210 GB:DIRECTION - GB:PRODUCT Cytochrome oxidase assembly GB:PROTEIN_ID ABA59481.1 GB:DB_XREF GI:76884800 InterPro:IPR000634 InterPro:IPR003780 LENGTH 342 SQ:AASEQ MSRRFYVFALAASLLALVVVVVGAYVRLSDAGLSCPDWPGCYQKLLAPTTEQQVDHANRLYPDRPVETAKAWKEMIHRYLAGILGLLILGLAIAAWRNRSDPTQKVALPLFLLGLVGLQAALGMWTVTLLVQPAIVTLHLLGGMAVLALVWWLALRQRQARRPMEKIWYSPAFKLLALIGLFLLVLQIILGGWTSTNYAGFYCSDFPTCQGQWWPTMDFREAFTFWQPLGENYEGGRLAPEAAVAIHVIHRIGAVVVLIVLSALGIRAGLGRGTPALRSVGWIVVMLVLIQAALGIATAMGGIPLALAVAHNAVAALLLLAVVTLNHLLHPTGYPLQGATRL GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 214->304|CTAA_OCHA4|3e-04|42.3|78/357| PROS 165->178|PS00165|DEHYDRATASE_SER_THR|PDOC00149| TM:NTM 8 TM:REGION 5->27| TM:REGION 74->95| TM:REGION 105->127| TM:REGION 134->156| TM:REGION 171->193| TM:REGION 243->265| TM:REGION 277->299| TM:REGION 305->327| SEG 7->28|vfalaasllalvvvvvgayvrl| SEG 80->95|lagilgllilglaiaa| SEG 107->123|alplfllglvglqaalg| SEG 145->155|avlalvwwlal| SEG 175->192|llaliglfllvlqiilgg| SEG 305->330|lalavahnavaallllavvtlnhllh| RP:PFM:NREP 1 RP:PFM:REP 31->304|PF02628|3e-08|26.9|238/283|COX15-CtaA| HM:PFM:NREP 1 HM:PFM:REP 7->323|PF02628|6.8e-91|41.4|292/301|COX15-CtaA| GO:PFM:NREP 2 GO:PFM GO:0006461|"GO:protein complex assembly"|PF02628|IPR003780| GO:PFM GO:0016020|"GO:membrane"|PF02628|IPR003780| OP:NHOMO 136 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111-1-1111----------111--------------------------------------------------------------111111111111111111111111111---11-1--------------------------------------------------------------------------------------------1-----1111111---------------------------1111111111111111----------------1-----111111111111111111111--------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 161-170| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccc //