[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59498.1
DDBJ      :             Histidine triad (HIT) protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  736/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->112 1rzyA PDBj 2e-22 40.6 %
:RPS:SCOP  7->109 1av5A  d.13.1.1 * 1e-22 39.8 %
:HMM:SCOP  6->116 1emsA1 d.13.1.1 * 5.1e-34 41.4 %
:RPS:PFM   7->107 PF11969 * DcpS_C 1e-14 38.0 %
:HMM:PFM   16->111 PF01230 * HIT 2e-27 45.2 93/98  
:BLT:SWISS 7->108 HITA_NEIGO 2e-25 46.1 %
:PROS 90->108|PS00892|HIT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59498.1 GT:GENE ABA59498.1 GT:PRODUCT Histidine triad (HIT) protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3449192..3449539 GB:FROM 3449192 GB:TO 3449539 GB:DIRECTION + GB:PRODUCT Histidine triad (HIT) protein GB:PROTEIN_ID ABA59498.1 GB:DB_XREF GI:76884817 InterPro:IPR001310 LENGTH 115 SQ:AASEQ MAIDQTDCIFCKIIEGELPAKVVYEDDQVIAFEDIHPKAKIHLLLVPRSHISSLEQLEVKHEALISHLLLLLPDLARRQGLQDGFRTIINTGRGGGQEVDHLHIHLLGGSQLPGF GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 7->108|HITA_NEIGO|2e-25|46.1|102/107| PROS 90->108|PS00892|HIT_1|PDOC00694| SEG 64->81|lishlllllpdlarrqgl| BL:PDB:NREP 1 BL:PDB:REP 7->112|1rzyA|2e-22|40.6|106/114| RP:PFM:NREP 1 RP:PFM:REP 7->107|PF11969|1e-14|38.0|100/113|DcpS_C| HM:PFM:NREP 1 HM:PFM:REP 16->111|PF01230|2e-27|45.2|93/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 7->109|1av5A|1e-22|39.8|103/113|d.13.1.1| HM:SCP:REP 6->116|1emsA1|5.1e-34|41.4|111/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 1056 OP:NHOMOORG 930 OP:PATTERN 11-1----111111121111111-11111111---11111111------1111-111-1----1-111 111-2---------211----1--1------1122212111--1--111--1------111-1-1221-111111111-112111111--------------------1-1111111111111111111111111111111111-211111111111111-111111111111111111111111-11--11-1111111111111111111111111111111111111121-11111111111111111111111221111111111111----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111--------1-1----------------------11-11-1--11-----------1-11---1-21111-1111111111---11111111111111111-----11-----1111111111122211111111211111111111111111212111-1-1111121111111111111111111111111-1-11111---111111111111111111111111111111111111111111111111--1111111111111111111111111111111--11111--11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-111111111111211111111111111111111111111111-1111121111111-111111111111111111111111111111111111111111111111111111-1------------1-11-1----111-1111111-11------11 1111211-3111---1111---1----11----1--11111111-1-1--111111--1----1111--11-111-1----1111111-321112-11-1--1----131421223-1-32-2134-22283-2252122412322112-21-3112213121323122321122111171111133351242211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 93.0 SQ:SECSTR ######ccHHHHHHTTcccccEEEEcccEEEEEcccccccEEEEEEEccccccGGGccGGGHHHHHHHHHHHHHHHHHTTcTTcEEEEcccHHHHTcccccccEEEEEccccc## DISOP:02AL 1-2, 114-115| PSIPRED cccccccccEEEEEccccccEEEEEccEEEEEEcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEcccccccc //