[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59508.1
DDBJ      :             transfer origin protein, TraL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->252 1cp2A PDBj 5e-06 13.0 %
:RPS:SCOP  4->41 1f48A1  c.37.1.10 * 7e-05 36.8 %
:HMM:SCOP  1->49 1g3qA_ c.37.1.10 * 1.2e-07 30.6 %
:HMM:PFM   6->43 PF02374 * ArsA_ATPase 1.2e-06 42.1 38/305  
:BLT:SWISS 1->237 TRAL4_ECOLX 1e-71 52.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59508.1 GT:GENE ABA59508.1 GT:PRODUCT transfer origin protein, TraL GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 3456442..3457257 GB:FROM 3456442 GB:TO 3457257 GB:DIRECTION + GB:PRODUCT transfer origin protein, TraL GB:PROTEIN_ID ABA59508.1 GB:DB_XREF GI:76884827 LENGTH 271 SQ:AASEQ MARAHFTLQGKGGVGKSLVSALIAQHRQENNIPLICVDTDPVNATFSGYTAFPVKRIELLKENTIDEREFDRLMELIVDNRDTEIVIDNGASSFIPLSSYLVENEAIDMLHSLGHSIIIHPVVTGGQSLLDTLSGFDALASQFPASADMVVWLNYYFGPIEKEGKTFEEMKVYQDHKGRVKGVVRIDRHNQATFGEDMQQMLENRMTFSQAIESEKFKLMAKQRLRKMKDELFKQMDQILAVSEKPVAKKHSAAEAKKPKKVSRTSSKRSE GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|TRAL4_ECOLX|1e-71|52.1|236/241| RP:PDB:NREP 1 RP:PDB:REP 10->252|1cp2A|5e-06|13.0|238/269| HM:PFM:NREP 1 HM:PFM:REP 6->43|PF02374|1.2e-06|42.1|38/305|ArsA_ATPase| RP:SCP:NREP 1 RP:SCP:REP 4->41|1f48A1|7e-05|36.8|38/296|c.37.1.10| HM:SCP:REP 1->49|1g3qA_|1.2e-07|30.6|49/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------1-------------------1----------1------1--1-----1--------1-1------1-----1--------------------------------------------------------------1------------------1---------------1-----------1-----------------------------------1-------------------------1--------------2----1------------------------------------------1--------------1-----------------------1----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 89.7 SQ:SECSTR #########EcTTccHHHHHHHHHHHHHTTTccEEEEEEcTTccccHHHHTcccccHHHHHHHGGGccHHHHcEEcGGGcEEEEcccccTTcccHHHHHHHHHHHHTTcccTTccEEEEEEEEEcccccTTTTHHHHTTcccHGGEEEEEEcccHHHHHHHHHHHHHHHHcTTcccEEEEEEEEcccccccHHHHHHHHHHHTccEcccHHHHHTTccHHHHcTTcHHHHHHHHHHHHHHHccccccccccc################### DISOP:02AL 246-271| PSIPRED ccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccccEEEcccccccEEEEccccccHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccHHHHHHHccEEEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHccccHHHHHHHHHHHHHHEEEEEEEcccHHHHHHHHHHHHHccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHEEEccccccccccHHHHcccHHHHHccccccc //