[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59514.1
DDBJ      :             H+-transporting two-sector ATPase, delta/epsilon subunit
Swiss-Prot:ATPE_NITOC   RecName: Full=ATP synthase epsilon chain;AltName: Full=ATP synthase F1 sector epsilon subunit;AltName: Full=F-ATPase epsilon subunit;

Homologs  Archaea  0/68 : Bacteria  414/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.2.10b.93.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->83 1fs0E PDBj 2e-23 54.9 %
:RPS:PDB   2->83 1bshA PDBj 7e-27 54.9 %
:RPS:SCOP  4->83 1aqtA2  b.93.1.1 * 2e-25 53.8 %
:HMM:SCOP  3->87 1aqtA2 b.93.1.1 * 2.4e-25 47.1 %
:HMM:SCOP  88->137 1aqtA1 a.2.10.1 * 1.2e-12 66.0 %
:RPS:PFM   5->83 PF02823 * ATP-synt_DE_N 4e-18 50.6 %
:HMM:PFM   5->84 PF02823 * ATP-synt_DE_N 4e-33 51.2 80/80  
:HMM:PFM   89->134 PF00401 * ATP-synt_DE 4.9e-16 52.2 46/48  
:BLT:SWISS 1->140 ATPE_NITOC 5e-49 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59514.1 GT:GENE ABA59514.1 GT:PRODUCT H+-transporting two-sector ATPase, delta/epsilon subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3466362..3466784) GB:FROM 3466362 GB:TO 3466784 GB:DIRECTION - GB:PRODUCT H+-transporting two-sector ATPase, delta/epsilon subunit GB:PROTEIN_ID ABA59514.1 GB:DB_XREF GI:76884833 InterPro:IPR001469 LENGTH 140 SQ:AASEQ MAMTMHVDIVSAEREIFSGTVNMLFAPAEMGEVGIMPRHTPLITRLKPGEVRLQRPEGQEDFFYVSGGLLEVQPHVVTVLADTAQRAADIDEAAALAAKQRAEEALQDREGKLDYARAQAELAEAIAQLKAIQRIRKKLG GT:EXON 1|1-140:0| SW:ID ATPE_NITOC SW:DE RecName: Full=ATP synthase epsilon chain;AltName: Full=ATP synthase F1 sector epsilon subunit;AltName: Full=F-ATPase epsilon subunit; SW:GN Name=atpC; OrderedLocusNames=Noc_3073; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(1);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|ATPE_NITOC|5e-49|100.0|140/140| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| COIL:NAA 60 COIL:NSEG 1 COIL:REGION 80->139| SEG 84->107|aqraadideaaalaakqraeealq| SEG 116->132|araqaelaeaiaqlkai| BL:PDB:NREP 1 BL:PDB:REP 2->83|1fs0E|2e-23|54.9|82/128| RP:PDB:NREP 1 RP:PDB:REP 2->83|1bshA|7e-27|54.9|82/138| RP:PFM:NREP 1 RP:PFM:REP 5->83|PF02823|4e-18|50.6|79/80|ATP-synt_DE_N| HM:PFM:NREP 2 HM:PFM:REP 5->84|PF02823|4e-33|51.2|80/80|ATP-synt_DE_N| HM:PFM:REP 89->134|PF00401|4.9e-16|52.2|46/48|ATP-synt_DE| GO:PFM:NREP 4 GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF02823|IPR020546| GO:PFM GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|PF02823|IPR020546| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF02823|IPR020546| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF02823|IPR020546| RP:SCP:NREP 1 RP:SCP:REP 4->83|1aqtA2|2e-25|53.8|80/85|b.93.1.1| HM:SCP:REP 3->87|1aqtA2|2.4e-25|47.1|85/85|b.93.1.1|1/1|Epsilon subunit of F1F0-ATP synthase N-terminal domain| HM:SCP:REP 88->137|1aqtA1|1.2e-12|66.0|50/0|a.2.10.1|1/1|Epsilon subunit of F1F0-ATP synthase C-terminal domain| OP:NHOMO 432 OP:NHOMOORG 415 OP:PATTERN -------------------------------------------------------------------- ----------1---11111-1111-111111-1111--------1--11--1--------11------11------------------------------------------------------------------1111111111---------------------------------------------111111111111111111-11111111111-11111111111----------------------1--------------1------------------------------------------------------------------------------------1--111-1-1--------1--1111------1-----1-----------------11-11-11--1--11-------1--1111-11------1--------111-1--1-----------------------------------11111122121111111111111111121111111222112111111111112111111111111111111-111-1--1----1------------1----1----------------------11-331111111111111111111111111111111-1111111-11111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111---------1111211111212111111111111111111-------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 59.3 SQ:SECSTR ccccEEEEEEccccccEEEEEccccEEcccccccccTTccccccccccEEEEEcccccccEEEEEccEEEEEccccEEEEEcc######################################################### DISOP:02AL 103-114, 139-140| PSIPRED cccEEEEEEEccccEEEEccEEEEEEEccccEEEEccccccEEEEEccEEEEEEEccccEEEEEEEccEEEEEccEEEEEEEccEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //