[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59516.1
DDBJ      :             Sodium-transporting two-sector ATPase
Swiss-Prot:ATPG_NITOC   RecName: Full=ATP synthase gamma chain;AltName: Full=ATP synthase F1 sector gamma subunit;AltName: Full=F-ATPase gamma subunit;

Homologs  Archaea  2/68 : Bacteria  866/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.49.2
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->250 1fs0G PDBj 4e-70 58.4 %
:BLT:PDB   234->288 3fksY PDBj 9e-08 43.6 %
:RPS:PDB   2->289 1e79G PDBj 3e-85 29.9 %
:RPS:SCOP  2->289 1e79G  c.49.2.1 * 6e-77 31.3 %
:HMM:SCOP  5->290 1mabG_ c.49.2.1 * 2.9e-97 48.5 %
:RPS:PFM   5->289 PF00231 * ATP-synt 2e-77 50.9 %
:HMM:PFM   2->289 PF00231 * ATP-synt 3e-113 47.2 288/290  
:BLT:SWISS 1->289 ATPG_NITOC e-156 100.0 %
:PROS 275->288|PS00153|ATPASE_GAMMA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59516.1 GT:GENE ABA59516.1 GT:PRODUCT Sodium-transporting two-sector ATPase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3468265..3469134) GB:FROM 3468265 GB:TO 3469134 GB:DIRECTION - GB:PRODUCT Sodium-transporting two-sector ATPase GB:PROTEIN_ID ABA59516.1 GB:DB_XREF GI:76884835 InterPro:IPR000131 LENGTH 289 SQ:AASEQ MASGKEIRSKIASVKNTQKITRAMEMVAASKMRKAQDRMRASRPYADKIRNVIRHLAQAHQEYQHPYLTSREAKKVGFIIVSSDRGLCGGLNTNLFRTLLRTMREWDEKGVPVELCIIGQKANAFFRRFGGSIAAQATHLGDSPHVEDLIGTVKVMLDNYQEGNVDRLYLAFNEFVNTMTQRPEIEQLLPIDANVGKTDEKLEHRWDYLYEPEAKEVLDQVLIRYIESLVYQGVVENIACEQAARMVAMKAASDNAGGFIDDLQLAYNKARQAAITQELSEIVGGAAAL GT:EXON 1|1-289:0| SW:ID ATPG_NITOC SW:DE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP synthase F1 sector gamma subunit;AltName: Full=F-ATPase gamma subunit; SW:GN Name=atpG; OrderedLocusNames=Noc_3075; SW:KW ATP synthesis; CF(1); Complete proteome; Hydrogen ion transport;Ion transport; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->289|ATPG_NITOC|e-156|100.0|289/289| GO:SWS:NREP 5 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 275->288|PS00153|ATPASE_GAMMA|PDOC00138| SEG 91->102|lntnlfrtllrt| BL:PDB:NREP 2 BL:PDB:REP 19->250|1fs0G|4e-70|58.4|219/219| BL:PDB:REP 234->288|3fksY|9e-08|43.6|55/187| RP:PDB:NREP 1 RP:PDB:REP 2->289|1e79G|3e-85|29.9|261/263| RP:PFM:NREP 1 RP:PFM:REP 5->289|PF00231|2e-77|50.9|285/289|ATP-synt| HM:PFM:NREP 1 HM:PFM:REP 2->289|PF00231|3e-113|47.2|288/290|ATP-synt| GO:PFM:NREP 4 GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00231|IPR000131| GO:PFM GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|PF00231|IPR000131| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF00231|IPR000131| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF00231|IPR000131| RP:SCP:NREP 1 RP:SCP:REP 2->289|1e79G|6e-77|31.3|262/263|c.49.2.1| HM:SCP:REP 5->290|1mabG_|2.9e-97|48.5|268/270|c.49.2.1|1/1|ATP synthase (F1-ATPase), gamma subunit| OP:NHOMO 1185 OP:NHOMOORG 1047 OP:PATTERN --------------------------------------------------11---------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111211111111--11-11111111111--------------11111111111211111111112211111111111111121111111111111111111-----1-1111111111111111111111111111111111122222111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111-1--122111111111111--11-11112111111111111121111111111111111111-11111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111122121111111111111111121111111111111111212111111111111111111111111111111211121111111111122111111211111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111121111121211111111111111111111111111----------1----1-11111111111111111111111111111111 11--111-1-----1111111111111111111111111111111111111111111111111-11--11111111111111111111-11111111111111222-15-2131112111111132-213A2-32411111111-1111-1-1112111111-2112311211212222Z2222272641322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 99.7 SQ:SECSTR #ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccTTTTcccccccccEEEEcccccccTTHHHHHHHHHHHHHHHcccccTTccEEEEcHHHHHHcGGGcTTccEEEcccccccccHHHHHHHHHHHHHTcccccccEEEEEEEEEETTEEEEEEEEETTcTTHHHHHHHTTccGGGGccccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc DISOP:02AL 288-290| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //