[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59518.1
DDBJ      :             H+-transporting two-sector ATPase, delta (OSCP) subunit
Swiss-Prot:ATPD_NITOC   RecName: Full=ATP synthase subunit delta;AltName: Full=ATP synthase F(1) sector subunit delta;AltName: Full=F-type ATPase subunit delta;         Short=F-ATPase subunit delta;

Homologs  Archaea  0/68 : Bacteria  594/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
a.70.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->107 1abvA PDBj 8e-15 34.3 %
:RPS:PDB   2->107 1abvA PDBj 2e-21 32.4 %
:RPS:SCOP  2->107 1abvA  a.70.1.1 * 2e-21 32.4 %
:HMM:SCOP  2->107 1abvA_ a.70.1.1 * 8.3e-23 35.2 %
:RPS:PFM   7->176 PF00213 * OSCP 7e-27 42.4 %
:HMM:PFM   7->176 PF00213 * OSCP 2e-54 43.5 170/172  
:BLT:SWISS 1->178 ATPD_NITOC 5e-95 100.0 %
:PROS 138->157|PS00389|ATPASE_DELTA

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59518.1 GT:GENE ABA59518.1 GT:PRODUCT H+-transporting two-sector ATPase, delta (OSCP) subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3470724..3471260) GB:FROM 3470724 GB:TO 3471260 GB:DIRECTION - GB:PRODUCT H+-transporting two-sector ATPase, delta (OSCP) subunit GB:PROTEIN_ID ABA59518.1 GB:DB_XREF GI:76884837 InterPro:IPR000711 LENGTH 178 SQ:AASEQ MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTVTESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTFSRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH GT:EXON 1|1-178:0| SW:ID ATPD_NITOC SW:DE RecName: Full=ATP synthase subunit delta;AltName: Full=ATP synthase F(1) sector subunit delta;AltName: Full=F-type ATPase subunit delta; Short=F-ATPase subunit delta; SW:GN Name=atpH; OrderedLocusNames=Noc_3077; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(1);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|ATPD_NITOC|5e-95|100.0|178/178| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 138->157|PS00389|ATPASE_DELTA|PDOC00327| BL:PDB:NREP 1 BL:PDB:REP 2->107|1abvA|8e-15|34.3|105/105| RP:PDB:NREP 1 RP:PDB:REP 2->107|1abvA|2e-21|32.4|105/105| RP:PFM:NREP 1 RP:PFM:REP 7->176|PF00213|7e-27|42.4|170/171|OSCP| HM:PFM:NREP 1 HM:PFM:REP 7->176|PF00213|2e-54|43.5|170/172|OSCP| GO:PFM:NREP 4 GO:PFM GO:0005886|"GO:plasma membrane"|PF00213|IPR000711| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00213|IPR000711| GO:PFM GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|PF00213|IPR000711| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF00213|IPR000711| RP:SCP:NREP 1 RP:SCP:REP 2->107|1abvA|2e-21|32.4|105/105|a.70.1.1| HM:SCP:REP 2->107|1abvA_|8.3e-23|35.2|105/105|a.70.1.1|1/1|N-terminal domain of the delta subunit of the F1F0-ATP synthase| OP:NHOMO 729 OP:NHOMOORG 713 OP:PATTERN -------------------------------------------------------------------- -11--111111--1-----------------------------------------1-------------------------11---11-----1------1-111--111---------------11111111111---1-111-1-11111111111111-1111111111-11111-1111--------11111111111111111111111111111111-111111111111111111111111111----1-1--11-11111--1-1111-------------------------------------1---------111-1----------11111111--1--11-11111111--11--1---11-1111111-11111111111111111111111111-11111111111-1111111111111111-1111111111111111111--1-1--11-11-----1---11-------------1111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111-1111111-211111111-------------------------11111-111111111111111111111111111-1111111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111112121111111111111111111-----------------------------1--------------1-11-1------ ------------11111--1111111-1111-1111111111111111111111--111111--1-11-1-111-------1111111----11-11111----12-1--2-3111-1-1--1-1111-131-111-1--1-11-111--1-1211111111-1---1-1112--111-----114------1-1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 62.9 SQ:SECSTR ccccHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHTcHHHHHHHTccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHTTcGGGHHHHHHHHHHHHHHHHHcccccc################################################################## DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEEcHHHHcEEEEEEccEEEEHHHHHHHHHHHHHHcc //