[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59520.1
DDBJ      :             ATP synthase F0, C subunit
Swiss-Prot:ATPL_NITOC   RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c;         Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein;

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->81 1a91A PDBj 4e-08 45.5 %
:RPS:SCOP  38->81 1ijpA  f.17.1.1 * 2e-07 43.2 %
:HMM:SCOP  5->83 1c99A_ f.17.1.1 * 1.3e-13 34.2 %
:HMM:PFM   14->81 PF00137 * ATP-synt_C 6.4e-17 35.9 64/66  
:BLT:SWISS 1->94 ATPL_NITOC 8e-38 100.0 %
:PROS 44->65|PS00605|ATPASE_C
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59520.1 GT:GENE ABA59520.1 GT:PRODUCT ATP synthase F0, C subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3471807..3472091) GB:FROM 3471807 GB:TO 3472091 GB:DIRECTION - GB:PRODUCT ATP synthase F0, C subunit GB:PROTEIN_ID ABA59520.1 GB:DB_XREF GI:76884839 InterPro:IPR000454 InterPro:IPR002379 InterPro:IPR005953 LENGTH 94 SQ:AASEQ MDPELLVSIYASTAVSVGIILAAAGLGSALGWGLICSKYLEGIARQPEMRPQLMGQMLFTGGLMEAFPMIVLGMSMWFIFANPFTGAALAAIGS GT:EXON 1|1-94:0| SW:ID ATPL_NITOC SW:DE RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein; SW:GN Name=atpE; OrderedLocusNames=Noc_3079; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(0);Complete proteome; Hydrogen ion transport; Ion transport;Lipid-binding; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|ATPL_NITOC|8e-38|100.0|94/94| GO:SWS:NREP 10 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0008289|"GO:lipid binding"|Lipid-binding| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 44->65|PS00605|ATPASE_C|PDOC00526| TM:NTM 2 TM:REGION 12->34| TM:REGION 62->84| SEG 18->35|giilaaaglgsalgwgli| BL:PDB:NREP 1 BL:PDB:REP 38->81|1a91A|4e-08|45.5|44/79| HM:PFM:NREP 1 HM:PFM:REP 14->81|PF00137|6.4e-17|35.9|64/66|ATP-synt_C| RP:SCP:NREP 1 RP:SCP:REP 38->81|1ijpA|2e-07|43.2|44/79|f.17.1.1| HM:SCP:REP 5->83|1c99A_|1.3e-13|34.2|79/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------1-------1------1-------1-1---------------------------------------------------------------------------------------------1------------1----------------111111111-----------------------------1111-1111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 53.2 SQ:SECSTR ####################################HHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGG######## DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcc //