[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA59521.1
DDBJ      :             H+-transporting two-sector ATPase, A subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  619/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.18.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->259 1c17M PDBj 2e-36 56.4 %
:RPS:SCOP  86->259 1c17M  f.18.1.1 * 6e-21 46.1 %
:HMM:SCOP  85->259 1c17M_ f.18.1.1 * 1.8e-37 36.1 %
:RPS:PFM   31->259 PF00119 * ATP-synt_A 1e-16 35.5 %
:HMM:PFM   29->259 PF00119 * ATP-synt_A 1.6e-57 34.7 213/215  
:BLT:SWISS 4->267 ATP6_SHEFN 9e-71 50.6 %
:PROS 194->203|PS00449|ATPASE_A
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA59521.1 GT:GENE ABA59521.1 GT:PRODUCT H+-transporting two-sector ATPase, A subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(3472149..3472952) GB:FROM 3472149 GB:TO 3472952 GB:DIRECTION - GB:PRODUCT H+-transporting two-sector ATPase, A subunit GB:PROTEIN_ID ABA59521.1 GB:DB_XREF GI:76884840 InterPro:IPR000568 LENGTH 267 SQ:AASEQ MSAESNPVEYINHHLTNLCIGQCESMGFWSLKLDTLFISLGLAALLVYASYRVGRHLHLSEPGGMQNVLEVVVEFVDQQVKDIFPGRNPLIGPLAITVFLWVFLMNAMDLIPVDLLPKLAEVMGIHGFKAVPTTEIDTTFALALTVFALIIYYNVKIKGPLGYIKQFLFHPFGKYLVPINIIMTTIEEVAKPVSLGLRLFGNMFAGELVFLLIALLSLAGFGAAWLPQVILGTLWAIFHILVITIQAFIFMLLTIVYLAMAHTEEEH GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 4->267|ATP6_SHEFN|9e-71|50.6|257/264| PROS 194->203|PS00449|ATPASE_A|PDOC00420| TM:NTM 5 TM:REGION 33->55| TM:REGION 96->118| TM:REGION 135->156| TM:REGION 209->231| TM:REGION 240->261| SEG 208->226|lvflliallslagfgaawl| BL:PDB:NREP 1 BL:PDB:REP 86->259|1c17M|2e-36|56.4|140/142| RP:PFM:NREP 1 RP:PFM:REP 31->259|PF00119|1e-16|35.5|211/215|ATP-synt_A| HM:PFM:NREP 1 HM:PFM:REP 29->259|PF00119|1.6e-57|34.7|213/215|ATP-synt_A| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00119|IPR000568| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00119|IPR000568| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00119|IPR000568| RP:SCP:NREP 1 RP:SCP:REP 86->259|1c17M|6e-21|46.1|141/142|f.18.1.1| HM:SCP:REP 85->259|1c17M_|1.8e-37|36.1|169/171|f.18.1.1|1/1|F1F0 ATP synthase subunit A| OP:NHOMO 657 OP:NHOMOORG 624 OP:PATTERN --------------------------------------------------11---------------- 11-----1---11-11111-111111111111111111111-11---11-----------1---------1-----------1-111---------1---1--1-----1--------------12----111-11----------2--111111--11-1-12--11--1111111111111-------11-111111111111111111111111111111-1111111-11111111111111111----11-11111-1111--111-11111111111111---1111111111111111111111111--------1-1----------1-111---11-1-1---111111111-1111--1--11-1-----1-11-21-12--------------------11-1111--1--------1---11-1---11-2-22-1111111111------1-1111111111111---1111111111111--11--1111111111111111112111111111311111111111111121211112111111111111111211112-11121111----1111--111----1-2111-1-----1111111111111-11111111111121211111121111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111-11111111111111111111111111111122221111111111111111111111111111121111111111111111111111111111111211111212111111111111111111--------------------------------------------11111-1---2-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------4-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 52.4 SQ:SECSTR #####################################################################################cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTT############################HHHHHHHHHHHHHHHHHHHHHHHHHHHccccH######HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc######## DISOP:02AL 1-4, 259-260, 262-267| PSIPRED ccccccHHHHHHHHHHccEEcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //